KEGG   Anolis carolinensis (green anole): 100555803Help
Entry
100555803         CDS       T01608                                 

Gene name
kat2b
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100555803 (kat2b)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100555803 (kat2b)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100555803 (kat2b)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100555803 (kat2b)
   HAT complexes
    PCAF complex
     100555803 (kat2b)
    STAGA complex
     100555803 (kat2b)
    TFTC complex
     100555803 (kat2b)
    SAGA complex
     100555803 (kat2b)
    SLIK complex
     100555803 (kat2b)
    ADA-HAT complex
     100555803 (kat2b)
    HAT-A2 complex
     100555803 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 834 aa AA seqDB search
MAEAGVAGPGEGDAGSSNGGAGALQQGSPASAGPPAAGAARASSSAAAAATPPAPAESSP
AAGGGGGSTGGTGGSARITGKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPP
PTPPRADLQQVVVNLTEPCRSCNHPLAAHVSHLENVSEEEMNRLLGIVLDIEYLFTCVHK
EEDADTKQVYFYLFKLLRKCILQMGKPVVEGSLESPPFEKPSIEQGVNNFVQYKFSHLPS
KERQTIVELAKMFLNRINYWHLETPSQRRQRSPNDDIAGYKVNYTRWLCYCNVPQFCDSL
PRYETTQVFGRTLLRSVFTVMRRQLLEHARQEKDKLPPEKRTLILTHFPKFLSMLEEEVY
SQSSPIWDPDFIASSSRNAQLGIQTVISHPPVVRSAACNASPSSLEQSSGGNMSPACKAI
SGLDQNLGEKRKINEAYSVEDAKKPRVVGDIPIELINEVMSTITDPAAMLGPETNFLSAH
SARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMMWLVGLQNVFSHQLPRMPKEYITRLV
FDPKHKTLALIKDGRVIGGICFRMFMSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHI
KHNILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKDYEGATLMGCELNPRIPYTE
FSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIETIPGIRETGWKPSSKEK
GKEPKDPDQLYSTLKNILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLK
NRYYVSKKLFMADLQRVFTNCREYNPPESEYYKCANILEKFFYTKIKEAGLIDK
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggctggcgtggccgggccgggggagggcgacgcggggagcagcaatggcggg
gctggggctctccagcaaggctcgccggcttcagcggggccgcccgctgcaggagccgct
cgagcttcctcctccgccgccgccgccgctactcctcctgcgcccgcggagagcagccct
gcagcgggaggaggaggaggaagcacgggagggactggcggctcggctcgcatcacgggc
aagaaggcgcagctccgatccgcaccccgcgccaagaagctggagaagttgggcgtctat
tccgcctgcaaggctgaggaatcctgcaaatgtaatggatggaaaaaccctaacccaccc
cctactccacccagggcagatctacagcaggtggttgtgaatctgaccgaaccatgtcgt
agctgtaatcatccattagctgcccatgtttcacatttggagaatgtctctgaagaagaa
atgaaccggcttttggggattgttctggatatagagtacctttttacctgtgttcataaa
gaagaagatgcagataccaagcaagtctatttctacttgttcaagcttttgaggaagtgt
atattacagatgggtaaacctgttgtagaaggatctttggaaagtccaccgtttgaaaaa
cctagcattgaacagggagtcaataattttgtgcaatacaaatttagtcaccttccatca
aaagagagacaaacaatagtagaactggctaaaatgttcctaaatcgcatcaactattgg
cacctggagacaccttctcagcgaagacagaggtcacctaatgatgacattgctggctat
aaagtgaactacacaagatggctttgctactgtaatgtcccccagttttgcgatagtcta
cctcgatatgaaaccacacaagtttttgggagaacacttctgcgttcagtgtttactgtc
atgagacgtcaacttctggaacatgctaggcaggaaaaagacaaacttcctcctgagaaa
cgaacactaattctcacacatttcccaaagttcctatccatgctggaggaagaggtctat
agtcaaagctctcccatctgggatccagattttattgcatcatcttctcgaaatgcacag
ctaggcatccagacagttattagccatcctcctgtggtgaggtccgctgcatgcaatgca
agcccctcatctctagaacaatccagtgggggaaatatgagtcctgcttgcaaggctatt
tctggtctggaccaaaacctaggagaaaaaagaaaaattaatgaggcttattctgtagag
gatgccaagaagccaagagtggtaggagatattcctattgagcttattaatgaagtgatg
tcaaccattacagatccagctgcaatgctggggccagagaccaactttctatccgcacat
tcagctcgggatgaggcagcgagactggaagagcgaaggggagtgattgaatttcatgtt
gttggaaattccctaaatcaaaagccaaataagaaaattatgatgtggttggttggctta
cagaatgtattttcacatcagctacccagaatgccaaaagaatatattactcgtctagtc
tttgatccgaaacacaagacccttgcattaataaaagatggacgagtgattggcggcatt
tgtttccggatgttcatgtctcaaggatttacagaaatcgttttctgtgctgtaacttcc
aatgagcaagtcaagggttatggaactcacttaatgaatcatctgaaagaatatcatatt
aagcataacattctcaactttctcacatatgcagatgaatatgcaattggctatttcaag
aaacaaggtttttctaaagatattaaagtaccaaaagcaaagtacgttggctatatcaaa
gattatgaaggagcaactttaatgggatgtgaattaaatccaagaattccatacactgaa
ttttcagtcattattaagaagcagaaagagattattaaaaagttgattgaaaggaagcaa
gctcagattcggaaagtttaccctggtctttcttgcttcaaagatggagtacgtcagatt
cctatagaaaccattcctggaattagagagactggatggaaaccaagcagcaaagagaaa
ggtaaagaacccaaagatccagatcagctctacagtacactaaaaaacattctgcaacag
gtcaagagccaccaaagcgcttggccattcatggaaccagtgaaaagaactgaagctcca
ggatattatgaagttataagattccccatggacctgaaaaccatgagtgaacgactgaag
aacagatactatgtgtctaagaagttattcatggcagatctgcagcgagtcttcactaac
tgccgagaatacaatccgccagaaagtgaatactataagtgtgccaatatactggagaaa
ttcttctacacaaaaattaaggaagctgggttaattgacaagtaa

DBGET integrated database retrieval system