KEGG   Anolis carolinensis (green anole): 100555810Help
Entry
100555810         CDS       T01608                                 

Gene name
bckdk
Definition
branched chain ketoacid dehydrogenase kinase
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     100555810 (bckdk)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100555810 (bckdk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 414 aa AA seqDB search
MMWKTLLMLEVGGVGGRAPCVFPFFVPAFRYRSSSAIDQQHELARERSKTVTSFYNQSTI
DVAAEKPSVRLTPTTMLYSGRSQDGSHLLKSARYLHHELPVRIAHRIKGFRSLPFIIGCN
PTILHVHELYIRAFQKLSEFPPIKDQEAEAQYCILVRQLLDDHKDVVTLLAEGLRECRKH
IQDEKVIRSFLDKTLTSRLGIRMLAIHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFAR
RLCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDIV
ITIANNDIDLIIRISDRGGGIPHDHVEKVTDYHFTTAEASTQDPRLNTLFGNMVEMGNSA
QSGPMHGFGFGLPTSRAYAEYLGGSLTLQSMQGIGTDVYLRLKHIDGKEESFRI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggaagacactgctgatgcttgaagtgggtggagtaggaggccgggctccctgt
gtgttcccattctttgtccctgctttccgataccggtcctcttcggccatcgatcagcag
catgagctggcgcgtgagcgatccaaaacagttacctctttctataaccagtcgaccatt
gacgtagcagccgaaaagccttctgtgaggttgacacccaccactatgctgtattctgga
cgttctcaggatggaagccacttattgaaaagcgcccgttatctgcatcatgaacttccg
gtccgcattgctcatcgcatcaaaggcttccggagcctcccctttattattggttgcaat
cccaccatcctccatgtgcatgaactttacatccgagcgttccagaagctgagtgaattc
cccccaattaaggaccaagaagctgaggcccagtactgcatactggtccgccaactccta
gatgaccacaaggatgttgtgacgctactggccgagggcttacgggagtgtcgtaagcac
atacaggatgagaaagtgatccgttcctttctggacaagactcttacctcccgcttgggt
atccggatgttggccatacaccaccttgctttacatgaggataagccagactttgttggg
atcatctgtacgcgcttgtctccaaagaaaatcattgagaaatgggtggattttgccagg
cgtctctgtgagcacaagtatgggaacgctccccgagtgagaatcaatgggcatgtggcc
gcccgctttcctttcatccccatgcctcttgattacatccttccagaattgctcaaaaat
gcaatgcgagccactatggaatctcacctggatacaccctacaatgtgccagacatagtc
atcaccattgccaacaatgacattgacctgatcatacggatttcagatcgagggggtgga
attcctcatgatcatgttgagaaggtaactgattaccacttcaccacagctgaagcaagt
actcaggatccccgcttgaacaccctcttcggaaacatggtggaaatggggaatagtgcc
cagtcggggcccatgcatgggtttggatttgggcttcccacctcccgtgcttatgccgag
tacctgggaggctccctcacactccagtccatgcaggggattggcacagatgtgtacctc
cgccttaaacacattgatggcaaagaggagagtttccgcatctag

DBGET integrated database retrieval system