KEGG   Anolis carolinensis (green anole): 100555818Help
Entry
100555818         CDS       T01608                                 

Definition
cyclic AMP-responsive element-binding protein 1-like
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
Adrenergic signaling in cardiomyocytes
Melanogenesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100555818
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100555818
Transcription factors [BR:acs03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100555818
Mitochondrial biogenesis [BR:acs03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100555818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 318 aa AA seqDB search
MTMESGADNQQSGDAAVTEAENQQMTVQPQIATLAQVSMPAGHGTSSAPTVTLVQLPNGQ
TVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRK
ILNDLSSDAPGVPRIEEEKSEEEAAAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANN
GTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRT
APTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNRSVSMVVFHQASLRVNNSGVPIG
FPWDLGGSSISPTTSLIF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggtgcagacaaccagcagagtggagacgcagctgttacagaagca
gaaaatcaacaaatgacggtacagccacaaatagcaacattagcccaggtatctatgcca
gcaggtcacggaacatcttctgctcccactgtaaccttagtacagctccccaacgggcag
actgttcaagtccatggtgttattcaggctgcccagccatcggtgattcagtctccacaa
gtccagacagttcagatatccaccattgcagagagtgaagattcacaggaatcagtagac
agtgtcacagactcccagaaacgcagggaaattctctccaggcgaccttcgtacagaaaa
atcttgaatgacttgtcctcagatgccccgggtgtgccaagaattgaagaagaaaagtct
gaagaggaagcagcagcacctgccatcactactgttacagtgccaactccaatttaccaa
acaagcagtgggcaatacattgctattacccagggcggtgcaatccagttagccaacaat
ggcacagatggagtccagggcctgcagacactgaccatgaccaatgctgctgcaacccag
cctggtaccaccattttacagtatgcccagaccacagacggacaacagattcttgtaccc
agcaaccaagttgttgtacaagctgcctcaggagatgtccagacttaccaaatccgcact
gcacccacaagcaccattgcccctggtgttgtcatggcatcgtccccagcccttcccacc
cagcctgcagaggaagcagcacgaaagagggaagtccgtctaatgaagaacaggtcagtg
agcatggtagtttttcatcaggctagtttaagggtgaataactctggggttcctattggc
tttccatgggaccttggagggtcaagcatatcacctaccacatctctgattttttaa

DBGET integrated database retrieval system