KEGG   Anolis carolinensis (green anole): 100555877Help
Entry
100555877         CDS       T01608                                 

Definition
mitogen-activated protein kinase 1-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100555877
   04012 ErbB signaling pathway
    100555877
   04350 TGF-beta signaling pathway
    100555877
   04370 VEGF signaling pathway
    100555877
   04068 FoxO signaling pathway
    100555877
   04150 mTOR signaling pathway
    100555877
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100555877
  Cell growth and death
   04114 Oocyte meiosis
    100555877
  Cellular commiunity
   04510 Focal adhesion
    100555877
   04520 Adherens junction
    100555877
   04540 Gap junction
    100555877
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100555877
   04621 NOD-like receptor signaling pathway
    100555877
  Endocrine system
   04910 Insulin signaling pathway
    100555877
   04912 GnRH signaling pathway
    100555877
   04914 Progesterone-mediated oocyte maturation
    100555877
   04916 Melanogenesis
    100555877
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100555877
   04270 Vascular smooth muscle contraction
    100555877
  Development
   04320 Dorso-ventral axis formation
    100555877
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100555877
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100555877
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100555877
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100555877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 368 aa AA seqDB search
MAAVSGAAGGSGANPAGGPEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVA
IKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTTDQMKDVYIVQDLMETDL
YKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKVCDFGLAR
VADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKH
YLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPYKNKVPWNRLFPNADAKALDLLDK
MLTFNPHKRIEVEEALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETA
RFQPGYRC
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtttcgggggcagccgggggcagcggggccaaccccgccgggggccccgag
atggtccgcgggcaggccttcgacgtgggaccccgctacaccaacctctcctacatcggc
gaaggggcctacggcatggtctgttctgcctatgacaatgtcaacaaagttcgggtggca
ataaagaagatcagcccttttgaacaccagacttactgccagaggactctgcgagaaatc
aaaatcctcttgcgtttcaagcatgaaaatattattggcatcaatgacattatcagagct
ccgacaactgatcaaatgaaagatgtatacattgtgcaagatctcatggagacagacctt
tacaagctcttaaagacccagcatctcagcaatgatcacatctgttatttcctttatcaa
atcctgagaggattgaaatatatccattcagccaatgtgctgcaccgtgacctcaagcct
tccaacttgctgctgaacacaacttgcgatcttaaggtctgtgactttgggttggctcgc
gttgcagatcccgatcatgaccacactggcttcctcaccgagtatgtggccacgcgttgg
tatcgagctcctgagattatgttgaattcaaagggctataccaaatctattgacatttgg
tcagtaggctgtattttggcggaaatgttatccaacagacccatctttccagggaaacac
tatctcgatcagctgaaccacattctgggaatacttgggtctccttctcaagaagaccta
aactgtataatcaatttgaaagctagaaactatttgctttctctaccgtacaaaaacaaa
gtgccgtggaacaggctgtttccaaatgctgacgccaaagctcttgatttgttggataag
atgttaaccttcaaccctcataaaagaattgaagttgaagaagctttggcccatccatat
ctagagcagtattacgatccaagtgatgagcctgtagcagaagcacctttcaaatttgac
atggaactagacgacctgccgaaggaaaagcttaaagaacttatttttgaggaaactgcc
agattccagccgggatacagatgctaa

DBGET integrated database retrieval system