KEGG   Anolis carolinensis (green anole): 100555955Help
Entry
100555955         CDS       T01608                                 

Definition
cytochrome P450 3A9-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100555955
   00591 Linoleic acid metabolism
    100555955
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100555955
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100555955
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP3 family
   100555955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 507 aa AA seqDB search
MELLPSFSIETWSFLVVLLGLLLLYGIWPFGVFGKLGIPGPRPWPFLGTLLQYRKGFVKF
DSWCFQKYGRIWGIYDGRQPVMAILDPAIIKTVLVKECYTTFTNRRNFGATGVLKSAISL
AEDEHWKRVRTVLSPTFTSGKLKEMFPIIKHYGEALMRNVQKKVDMDEPLVVKDVFGAYA
MDVVTSTSFGVNIDSMNNPKDPFVKEIQKLTKFRSFDPRIILLFTFPILRTVFEALNIQI
FSAEAVDFFTRSFAKMKAGRAGETKEGRVDFLQLMIDSQTSNGHHQSNGIDHTYKGLTDD
EILAQAFIFVFAGYEPTSNSLGYMAYMLATHPDVQQKLQDEIDSVLPNKAPLTYDAIMQL
EYLDMVLNETQRLYPLGGRIERVCKKDVEINGVTIPKGVVVMIPPYNLHRDQEYWPEPEE
FRPERFSKENKESVDPYTYLPFGAGPRNCIGMRFALVTMKVAITILLQHFSFRVCKETPI
PLELSSQAFLVPEKPIVLKLVRRNNLQ
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctcccaagcttctccatcgagacgtggtcatttctggtcgtcttgctggga
cttctcttgctatacgggatctggccattcggtgtgtttggcaaactaggcatcccgggt
cccaggccctggcctttcttgggaactctccttcagtaccgcaaaggttttgtgaagttt
gatagctggtgcttccagaaatatgggcgaatctgggggatttatgatggccggcaacct
gtaatggctatcctggatcctgctattattaaaacagtgctcgtgaaggaatgttacacc
accttcaccaaccgacggaattttggtgcaactggggtcttgaagtcggcgatttccttg
gcggaagacgaacactggaagagggtgcggaccgtgctttccccaaccttcaccagcggg
aagctaaaggagatgttccccattataaagcactacggggaggctttgatgcgaaatgtt
cagaagaaagtggatatggacgagcctctggttgtgaaggatgtctttggtgcctacgcc
atggatgtggtcaccagtacctccttcggggtgaacatcgactccatgaataatcccaag
gacccttttgtcaaagagatccaaaaactcaccaagtttcgctcttttgatcctcgtatc
attctgttgtttactttcccaattctccgaaccgtgtttgaggcgctgaacatccaaatc
ttctccgcagaagccgtagacttcttcacaaggtcattcgccaaaatgaaggcagggcga
gcgggggagaccaaagagggtcgagtggacttcttgcagctgatgattgactcccagact
tccaacggccaccaccaaagcaatgggattgatcatacatataaaggcttgaccgacgac
gaaatcctggcccaagcctttatttttgttttcgcggggtacgaacccaccagcaactcc
ctcggttacatggcctatatgttggccactcatccagatgttcagcagaagcttcaagat
gagatcgattctgtcctacccaacaaagccccactcacatacgatgccatcatgcaactg
gagtatctcgacatggtgttgaatgagacgcaacggctgtatcctctcggcgggcggatc
gaaagagtctgcaagaaagacgttgaaatcaacggggtgacgatccccaaaggcgtggtg
gtcatgatccctccttacaatctccaccgggatcaggaatactggccagaacctgaagag
tttagacctgagaggttcagcaaggagaacaaggaaagtgtggatccttacacctacctg
ccttttggagccggtcctcggaactgtatcgggatgagatttgctctcgtcaccatgaaa
gtggcgattaccatcctcttgcagcatttctccttcagagtctgcaaagaaacaccaatt
cctctggagctgagctctcaagcatttttagtgccagaaaagccgatcgttttgaagtta
gtgcgacgaaataatcttcagtga

DBGET integrated database retrieval system