KEGG   Anolis carolinensis (green anole): 100555955Help
Entry
100555955         CDS       T01608                                 

Definition
cytochrome P450 3A9-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:acs00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:acs00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:acs00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 507 aa AA seqDB search
MELLPSFSIETWSFLVVLLGLLLLYGIWPFGVFGKLGIPGPRPWPFLGTLLQYRKGFVKF
DSWCFQKYGRIWGIYDGRQPVMAILDPAIIKTVLVKECYTTFTNRRNFGATGVLKSAISL
AEDEHWKRVRTVLSPTFTSGKLKEMFPIIKHYGEALMRNVQKKVDMDEPLVVKDVFGAYA
MDVVTSTSFGVNIDSMNNPKDPFVKEIQKLTKFRSFDPRIILLFTFPILRTVFEALNIQI
FSAEAVDFFTRSFAKMKAGRAGETKEGRVDFLQLMIDSQTSNGHHQSNGIDHTYKGLTDD
EILAQAFIFVFAGYEPTSNSLGYMAYMLATHPDVQQKLQDEIDSVLPNKAPLTYDAIMQL
EYLDMVLNETQRLYPLGGRIERVCKKDVEINGVTIPKGVVVMIPPYNLHRDQEYWPEPEE
FRPERFSKENKESVDPYTYLPFGAGPRNCIGMRFALVTMKVAITILLQHFSFRVCKETPI
PLELSSQAFLVPEKPIVLKLVRRNNLQ
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctcccaagcttctccatcgagacgtggtcatttctggtcgtcttgctggga
cttctcttgctatacgggatctggccattcggtgtgtttggcaaactaggcatcccgggt
cccaggccctggcctttcttgggaactctccttcagtaccgcaaaggttttgtgaagttt
gatagctggtgcttccagaaatatgggcgaatctgggggatttatgatggccggcaacct
gtaatggctatcctggatcctgctattattaaaacagtgctcgtgaaggaatgttacacc
accttcaccaaccgacggaattttggtgcaactggggtcttgaagtcggcgatttccttg
gcggaagacgaacactggaagagggtgcggaccgtgctttccccaaccttcaccagcggg
aagctaaaggagatgttccccattataaagcactacggggaggctttgatgcgaaatgtt
cagaagaaagtggatatggacgagcctctggttgtgaaggatgtctttggtgcctacgcc
atggatgtggtcaccagtacctccttcggggtgaacatcgactccatgaataatcccaag
gacccttttgtcaaagagatccaaaaactcaccaagtttcgctcttttgatcctcgtatc
attctgttgtttactttcccaattctccgaaccgtgtttgaggcgctgaacatccaaatc
ttctccgcagaagccgtagacttcttcacaaggtcattcgccaaaatgaaggcagggcga
gcgggggagaccaaagagggtcgagtggacttcttgcagctgatgattgactcccagact
tccaacggccaccaccaaagcaatgggattgatcatacatataaaggcttgaccgacgac
gaaatcctggcccaagcctttatttttgttttcgcggggtacgaacccaccagcaactcc
ctcggttacatggcctatatgttggccactcatccagatgttcagcagaagcttcaagat
gagatcgattctgtcctacccaacaaagccccactcacatacgatgccatcatgcaactg
gagtatctcgacatggtgttgaatgagacgcaacggctgtatcctctcggcgggcggatc
gaaagagtctgcaagaaagacgttgaaatcaacggggtgacgatccccaaaggcgtggtg
gtcatgatccctccttacaatctccaccgggatcaggaatactggccagaacctgaagag
tttagacctgagaggttcagcaaggagaacaaggaaagtgtggatccttacacctacctg
ccttttggagccggtcctcggaactgtatcgggatgagatttgctctcgtcaccatgaaa
gtggcgattaccatcctcttgcagcatttctccttcagagtctgcaaagaaacaccaatt
cctctggagctgagctctcaagcatttttagtgccagaaaagccgatcgttttgaagtta
gtgcgacgaaataatcttcagtga

DBGET integrated database retrieval system