KEGG   Anolis carolinensis (green anole): 100555994Help
Entry
100555994         CDS       T01608                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1-like
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100555994
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100555994
   04070 Phosphatidylinositol signaling system
    100555994
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100555994
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100555994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 692 aa AA seqDB search
LGCLPIDIYIQGILCVRERGKRERENECDKYIIKCSLAWKGNEKGYLYRLSISLTGFAFT
WFLNVIHKKFKKGKLSFENTLELLGNFDIPFDYIHVKYIFKARNSLKSGTIGLDDFRGIY
QAIAHRSEIHELFKTHSPNHKVLPLSNLVAFLKNEQFQLEADETTASQLIAKFEPIEEAR
RNSEMTFEGFLRYMTSEDCMIFKTEHQSVYQDMTRPLCEYFISSSHNTYLISDQLIGPSH
LWGYASALMKGCRCLEIDCWDGPCNDPVVYHGHTLTSKISFKTVIQVINKYAFLVSNYPL
LLSLENHCSPRQQEVIADYLTSILGDKLVTSTIDDKMPNELPSPEALKFKILIKNKKLGT
LEETLARRGIDSHGQTGEFEEEESSEEEVADAPAHPKQPLLKKRRAQSRWKGSGPPRKKQ
QMKKIKMALELSDLVIYAKTRQFVSFEDSRENQLFYENTSIGEGRARKLEKLQADEFIQH
TARFLTRIYPKGTRTTSSNYNPQEFWNVGCQLVALNFQTPGLQMDLQTGKFLDNGGSGYI
LKPEYLRRIDPEFSPYTLATNRLPVLLTIKLISGHQLPPSSLSSTNKANPLVVIEIYGVP
EDQAKQHSCVVKGNALCPRWNETFTFNIQVPELALVRFAVEDQLSLTANDLLGQYTLPFL
SMNKGYRQVPLLSKLGVSLRPASLFVHVWYFD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
cttggctgtcttccaatagatatttatattcaaggcatcttgtgtgtgagagagagggga
aagagagagagagagaatgaatgtgataaatatattatcaagtgcagtttggcatggaaa
gggaatgagaaaggttatttatatagattgtcgatttccttaactggctttgcattcaca
tggtttctaaatgtcatccacaagaagtttaaaaaagggaagcttagttttgaaaatacc
ttggaattgcttggcaattttgacatcccttttgattacattcatgtgaaatacattttt
aaggcacgtaattcattgaaatctggaacaatcggtttagatgattttagaggaatttat
caggccatagcacacagaagcgaaattcatgaactcttcaaaactcattctccaaaccac
aaagttctcccgctatcaaatctagttgcatttcttaaaaatgagcagtttcaactggaa
gccgatgaaacaaccgcttctcaactcattgcaaaatttgagcccattgaagaagcaaga
agaaactctgagatgacatttgaaggctttctaagatacatgacttcagaggactgcatg
atttttaaaactgagcatcaaagtgtttaccaggatatgacccgtccattatgtgaatat
tttatttcatcctcacataacacctacctcatatctgatcagctaattgggccaagtcat
ctgtggggctatgcaagtgctctgatgaaaggatgtcgctgcttggaaattgactgctgg
gatgggccatgcaatgatcctgttgtttatcatggacacacattaacaagcaaaatcagt
tttaagactgtcatccaggtcatcaataagtatgcatttttggtctctaattaccctctg
ctcctgtctttggaaaatcactgcagccctagacagcaggaagtaatcgcagattatctg
acaagtatcctaggtgacaagttggttacatctacaattgatgataagatgccaaatgag
ttgccttctcctgaggcactgaaattcaaaatattgataaaaaataagaaacttggaaca
cttgaagaaacacttgcaaggaggggcattgacagccatggtcagacaggagaatttgaa
gaggaggaatcaagtgaggaggaggtagctgatgcccctgcccatcccaagcagcccctg
cttaagaaaagacgagcacaatcacgttggaaaggttcaggcccacctcgaaaaaagcaa
caaatgaagaaaataaagatggctctggaactgtcagaccttgtgatttatgctaaaact
cgacagtttgtaagctttgaagactccagagaaaatcaacttttttatgaaaatacttca
attggagagggaagagcccggaaactggaaaaactacaagctgatgaatttattcaacat
acagcccgatttcttacaagaatataccctaagggaacacgaaccacctcctccaattat
aatcctcaggagttctggaatgttggatgccagttggtggcattaaatttccaaacacct
ggactacaaatggatcttcaaactgggaaatttttagacaatggtggttctggatatatt
ctaaagccagagtatctcagaaggatagacccagagttttcaccctatactcttgctaca
aatcgtttacctgttcttcttacaataaagcttataagtggtcatcagttgccacctagc
agtctttcaagtactaataaagccaacccccttgttgtaatagaaatatatggcgttcca
gaagaccaggcaaaacaacacagttgtgtagttaaaggcaatgctttgtgtcctaggtgg
aatgaaacattcacatttaatatccaagttccagagcttgccttagtgcgatttgctgta
gaagaccagctttctctcacagccaatgacctccttggccagtacactttgccatttttg
agcatgaataaaggttatcgccaggttccactgctgtccaaacttggtgtcagtctgcga
cctgcttctctctttgtacatgtctggtattttgactaa

DBGET integrated database retrieval system