KEGG   Anolis carolinensis (green anole): 100556066Help
Entry
100556066         CDS       T01608                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100556066
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100556066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 230 aa AA seqDB search
MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSPHIKYICPHAPVMP
VSLNMNMAMPSWFDIIGLAPDSQEDEAGIKQASENVKALIEQEVRNGIPSNRIILGGFSQ
GGALSLYTALTTHQQLGGIVALSCWLPLRTSFPQGPINCVNKDISILQCHGDRDPLVPLM
FGSVTSETLKTMINPGNVTFKTYSGMMHSSCIEEMMDVKQFIDKHLPPVD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaacaacatgtccgccccgctccccgccatcgtcccggccgccaggaaggcc
accgccgcggttatatttcttcatggattaggagatactgggcatgggtgggcagaagca
tttgctggcattcgaagcccacacataaaatatatttgcccacatgcgccagttatgcca
gtttctctaaacatgaatatggccatgccttcttggtttgatattattggactggctcca
gattcacaggaggacgaagctggaatcaagcaggcatcagagaatgtgaaagcacttata
gagcaagaagtaagaaatggaataccttcaaacagaataatattgggaggattttctcag
ggaggagctttatcattgtacacagccctcacaacgcatcagcagttaggaggtattgta
gcactcagctgttggcttccgctgcggacttcttttccacagggccccatcaactgtgtc
aacaaggacatttccattcttcagtgtcacggtgaccgtgaccctttagttccattaatg
tttggttctgtcacttctgagacgttaaaaactatgataaatcctggcaatgtaactttc
aagacatattcaggcatgatgcatagctcatgtattgaggaaatgatggatgttaagcag
ttcattgacaagcacctacctccagttgactga

DBGET integrated database retrieval system