KEGG   Anolis carolinensis (green anole): 100556102Help
Entry
100556102         CDS       T01608                                 

Definition
cyclin-dependent kinase 4 inhibitor D-like
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
acs  Anolis carolinensis (green anole)
Pathway
FoxO signaling pathway
Cell cycle
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:acs04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:acs04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 168 aa AA seqDB search
MQPGGAEVRAGDRLTSAAARGDPEEVRRLLRQELLRPDARNRFGKTALQVMMFGNVFVAQ
ELLKHGANPNLQDASGTAPAHDAARTGFLDTLKVLVEYGADVNVPDASGSLPIHVATREG
HAEVVRFLAPLSRLRHQDSDGRTPLELARQLGLSPIQGILEQHLSAPA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgggcggcgccgaagtccgcgccggggaccgcctcaccagcgctgccgcccga
ggagaccccgaggaagtgcgccgcctcctccggcaggagctcctccgcccggatgcccgg
aaccgcttcgggaagaccgcgttgcaggttatgatgtttggcaacgtctttgtggcacag
gagctgctgaagcatggtgccaaccccaatcttcaagatgcgtcaggcacggcccctgcc
catgacgctgcccgcactggcttcctcgacaccctgaaggtcctggtggaatacggggct
gatgtcaacgtcccggacgcctccggctcgcttcccatccatgtcgccacccgggaaggc
cacgccgaggtggtgcgcttcctagcacccttgtcccggctgcggcaccaggactcggac
gggcgcacaccgctggagctggcgcggcagctgggcctttcacccatccagggcatcctg
gagcagcacctctctgccccagcttag

DBGET integrated database retrieval system