KEGG   Anolis carolinensis (green anole): 100556108Help
Entry
100556108         CDS       T01608                                 

Gene name
gtf2h4
Definition
general transcription factor IIH, polypeptide 4, 52kDa
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
acs  Anolis carolinensis (green anole)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100556108 (gtf2h4)
  Replication and repair
   03420 Nucleotide excision repair
    100556108 (gtf2h4)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100556108 (gtf2h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 460 aa AA seqDB search
MESVMKLQKVHLKCKNLHEFLRGLSPGVLDRLYNHPATCLAVFRELPGLAKNYVMRMLLL
EQPLPQAAVASWVKKEYTKEQEESSDILLGLRLWHKQLLPGGLQGIVLNPIFKENLRVAL
LGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVILDFMVGSPSAAVSQDLAQLLTEA
GLMKSSEPGEPPCITSSGFQFLLLDTSSQLWYFMLQYLQSAETRGMDLVEILSFLFQLSF
STLGKDYSVEGMSESLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGISGITIDTR
NQGFIIVETNYRIYAYTDSELQIALIALFSEMLYRFPNLVVAQVTRESVQQAIANGITAD
QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFSEGVLYNQFLSQVDFELLR
DHARELGVLIFENPSKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggtgatgaagctccagaaggtgcacttgaaatgcaagaacctgcacgaattc
ctgcgaggcctcagccccggggtcttggaccgtctctacaatcaccccgctacttgcctg
gctgtcttccgagagctgccaggcttggccaagaactatgttatgcggatgctgcttttg
gaacagcctcttcctcaggctgctgtggcatcatgggtaaaaaaggaatacactaaggaa
caggaggagagctcagatatcttgctgggtcttcggctgtggcacaagcagttgcttcca
gggggtctccaaggaattgtcttgaaccctatcttcaaggagaacttgcgtgttgccctg
ctgggaggtggtaaggcctggtctgatgacactagccagttaggaccagacaagcatgcc
cgggacgtcccatctctagacaaatatgctgaagaaaggtgggaggtcatcttggacttt
atggtgggctctcctagtgcagccgtgagtcaagatttggctcagctgctcactgaagct
ggcctgatgaagagtagtgagcctggcgaaccaccttgcattacctcttctggtttccag
ttcctcttgctagatacctcatcacaactctggtactttatgttgcagtacctccagtca
gctgagacccggggcatggacctggtggagattctttccttcctcttccagctcagcttc
tccactcttggcaaggattattccgtggaaggaatgagtgaatctttgctaaactttctc
caacacctccgggagtttggtcttgtctttcagagaaagaggaaatccaggcgttactat
ccaacccgcctagcaatcaacctttcctctggcatttcgggtattacgatagatactcgt
aaccagggctttatcattgtggagacaaactacaggatctatgcatacacagattctgag
ctgcagattgcactcattgccctcttctctgagatgttgtatcgctttccaaacttagtg
gtggctcaagtaacccgggagagtgtacaacaggcgattgccaatggcatcacagcagat
cagataattcacttcctgcgtactagagctcaccctgtgatgctgaaacagacccctgtg
ctgccccccacaatcacagaccaaatccggctatgggagctggaacgggacagattgcgc
ttctctgagggtgttctctacaaccagttcctctcccaggtggactttgagctgctgcgg
gaccatgccagggaactcggggtgctcatttttgagaacccttccaagcgtctgatggtg
gtgactcctgccggacactcagatgtcaaacgcttctggaagcgacagaaacacagttcc
tga

DBGET integrated database retrieval system