KEGG   Anolis carolinensis (green anole): 100556199Help
Entry
100556199         CDS       T01608                                 

Gene name
kat2a
Definition
(RefSeq) lysine acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100556199 (kat2a)
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100556199 (kat2a)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100556199 (kat2a)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100556199 (kat2a)
   HAT complexes
    PCAF complex
     100556199 (kat2a)
    STAGA complex
     100556199 (kat2a)
    TFTC complex
     100556199 (kat2a)
    SAGA complex
     100556199 (kat2a)
    SLIK complex
     100556199 (kat2a)
    ADA-HAT complex
     100556199 (kat2a)
    HAT-A2 complex
     100556199 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 853 aa AA seqDB search
MQLVIASMRRGAPATGIGASAWLLSMRSGIHAPTPPRRVLGIMAEPEVSLQTSARTPQAA
ASSAATASSVTAPPASSGGGSGGSSSTSSSDPVRPGLSQQQRASQRKAHARSFPRAKKLE
KLGVFSACKANDSCKCNGWKNPNPPTAPRMDLQQTVTNLSEPCRSCGHALADHVSHLENV
SEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSRPVVEGSLGSP
PFEKPNIEQGVLNFVQYKFSHLPPKERQTMFELSKMFLLCLNYWKLETPSQFRQRSQNDD
VATYKVNYTRWLCYCHVPQSCDSLPRYETTQVFGRNLLKSTFTVTRRQLLEKFRVEKDKL
VPEKRTLILTHFPKFLSMLEEEIYGESSPIWEADFTMPAAEGAPLVPRPAISTVPAASTP
LFNKSLSCSSSLASMNLDGSSLDSVPGEKRKLPESLTLEDAKRIRVLGDIPMELVNEVML
TITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQ
NVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSN
EQVKGYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKTRYVGYIKD
YEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVRHIP
IESIPGIRETGWKPLGKEKGKEFKDPDQLYTTLKNLLAQIKTHPSAWPFMEPVKKSEAPD
YYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPESDYCKCANTLEKF
FYFKLKEGGLIDK
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgcaactggttatagcgagcatgcgcagaggcgctccagccacaggcataggagcctcc
gcctggcttctgagcatgcgcagtggcatccatgcgcccacgccgcctcggagggtcctg
ggcatcatggcggagccggaggtttccttacagactagtgcccggaccccgcaggctgcc
gcatcctccgccgctaccgcctcttcagtcacagctccgcctgcgtcctccggaggcgga
tccggaggaagcagcagcaccagcagcagcgatccggttcgcccgggattaagtcagcaa
cagcgcgcgagtcagcgcaaagcgcatgcgcggagcttcccgcgggcaaaaaagctggag
aagctaggggtattttcagcgtgcaaggctaatgactcttgcaaatgcaatggctggaag
aacccaaaccctcccacagccccccgaatggatctgcagcagacagtcaccaacctcagt
gagccatgccgtagctgtgggcacgctctagctgaccatgtgtctcacctggagaacgtg
tctgaggatgagatcaatcggcttcttgggatggttgtggatgtggagaaccttttcatg
tctgtgcacaaggaagaggacaccgacaccaagcaggtttatttctacctgttcaagctc
ctgagaaaatgcattctgcagatgagccgcccagttgttgagggatctcttgggagcccc
ccgtttgagaaaccaaatattgaacagggtgttttaaactttgtgcagtacaagttcagc
cacctgcctcccaaggagcggcagaccatgtttgagctctccaagatgtttctcttgtgc
ctaaattattggaagctggaaacgccatcccagttccgccagcgctcacaaaacgatgac
gtggcaacttacaaagtcaattatacccggtggctgtgctactgccatgttccccagagt
tgtgacagccttcctcgatatgaaaccacccaggtctttgggcgcaacctgctcaagtcc
acctttacagtgactcgtcggcagctgctggagaaattcagagttgaaaaagacaagttg
gtgccagagaaacggactctcatcctcacccatttccccaaatttctgtcaatgttggag
gaagaaatctatggggagagttcaccaatctgggaggctgattttactatgcctgcagca
gaaggagcccctcttgttccccgtccagctatcagcacggtacctgcagccagtactccg
ctttttaacaaatctttgagttgtagctcatctttggcatccatgaaccttgatggcagt
tcattggattctgtgccaggtgaaaaaagaaaactccctgagagcttgactctggaggat
gccaagcggatccgtgtgttaggagacatcccaatggaacttgttaacgaagtgatgttg
acaatcacagatccagcagccatgctagggcctgagaccagtcttctgtcagcgaatgca
gcccgggatgagacggcccgacttgaggagcgtcgtggcataattgaattccatgtcatc
ggcaattcgctctcacagaaatcaaacaagaagattctcatgtggctggttggcttgcag
aatgttttttcacaccaactgcctcgaatgcccaaggaatacatcacccgcctggttttt
gaccctaaacacaagactttggctctgattaaggatggccgagtgatcggcggcatctgc
ttccggatgtttcctacacaggggttcacagagattgtcttctgtgcagtgacatccaat
gagcaagtcaagggctatgggacccacctgatgaatcacctaaaggagtaccacatcaag
cacagcattctctacttcctcacctatgcggatgaatatgccattggctacttcaagaag
cagggtttctccaaagacatcaaagtccccaagacacgatatgttggttatatcaaggac
tatgagggagccaccttgatggagtgtgaactgaatccccggattccctatacagagctc
tcgcatatcataaagaaacagaaggagatcatcaagaagctgattgaaaggaagcaggct
caaatccgcaaagtctacccgggcctcacttgcttcaaagaaggtgttcgccatatcccc
atcgaaagcattccaggcatccgggaaacaggatggaagcccctgggaaaggagaaaggg
aaagagttcaaggatccagatcagttgtataccaccttgaaaaacctccttgcacaaatc
aagacccaccccagcgcctggccattcatggaaccagtgaagaaatccgaggctccagac
tactatgagattattcgttttcctattgacctcaagacgatgaccgagcggcttaagaac
cgctactatgtcaccaagaagctgttcattgctgacttgcagcgcatcatcaccaactgc
cgtgaatacaatccgcccgagagtgattactgcaagtgtgccaatacccttgaaaagttc
ttctacttcaagctcaaggaagggggactcattgacaagtag

DBGET integrated database retrieval system