KEGG   Anolis carolinensis (green anole): 100556199Help
Entry
100556199         CDS       T01608                                 

Definition
histone acetyltransferase KAT2A-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100556199
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100556199
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100556199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 849 aa AA seqDB search
MRRGAPATGIGASAWLLSMRSGIHAPTPPRRVLGIMAEPEVSLQTSARTPQAAASSAATA
SSVTAPPASSGGGSGGSSSTSSSDPVRPGLSQQQRASQRKAHARSFPRAKKLEKLGVFSA
CKANDSCKCNGWKNPNPPTAPRMDLQQTVTNLSEPCRSCGHALADHVSHLENVSEDEINR
LLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSRPVVEGSLGSPPFEKPNI
EQGVLNFVQYKFSHLPPKERQTMFELSKMFLLCLNYWKLETPSQFRQRSQNDDVATYKVN
YTRWLCYCHVPQSCDSLPRYETTQVFGRNLLKSTFTVTRRQLLEKFRVEKDKLVPEKRTL
ILTHFPKFLSMLEEEIYGESSPIWEADFTMPAAEGAPLVPRPATLSISTVPAASTPLFNK
SLSCSSSLASMNLDGSSLDSVPGEKRKLPESLTLEDAKRIRVLGDIPMELVNEVMLTITD
PAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFS
HQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVK
GYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKTRYVGYIKDYEGA
TLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVRHIPIESI
PGIRETGWKPLGKEKGKEFKDPDQLYTTLKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEI
IRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPESDYCKCANTLEKFFYFK
LKEGGLIDK
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaggcgctccagccacaggcataggagcctccgcctggcttctgagcatgcgc
agtggcatccatgcgcccacgccgcctcggagggtcctgggcatcatggcggagccggag
gtttccttacagactagtgcccggaccccgcaggctgccgcatcctccgccgctaccgcc
tcttcagtcacagctccgcctgcgtcctccggaggcggatccggaggaagcagcagcacc
agcagcagcgatccggttcgcccgggattaagtcagcaacagcgcgcgagtcagcgcaaa
gcgcatgcgcggagcttcccgcgggcaaaaaagctggagaagctaggggtattttcagcg
tgcaaggctaatgactcttgcaaatgcaatggctggaagaacccaaaccctcccacagcc
ccccgaatggatctgcagcagacagtcaccaacctcagtgagccatgccgtagctgtggg
cacgctctagctgaccatgtgtctcacctggagaacgtgtctgaggatgagatcaatcgg
cttcttgggatggttgtggatgtggagaaccttttcatgtctgtgcacaaggaagaggac
accgacaccaagcaggtttatttctacctgttcaagctcctgagaaaatgcattctgcag
atgagccgcccagttgttgagggatctcttgggagccccccgtttgagaaaccaaatatt
gaacagggtgttttaaactttgtgcagtacaagttcagccacctgcctcccaaggagcgg
cagaccatgtttgagctctccaagatgtttctcttgtgcctaaattattggaagctggaa
acgccatcccagttccgccagcgctcacaaaacgatgacgtggcaacttacaaagtcaat
tatacccggtggctgtgctactgccatgttccccagagttgtgacagccttcctcgatat
gaaaccacccaggtctttgggcgcaacctgctcaagtccacctttacagtgactcgtcgg
cagctgctggagaaattcagagttgaaaaagacaagttggtgccagagaaacggactctc
atcctcacccatttccccaaatttctgtcaatgttggaggaagaaatctatggggagagt
tcaccaatctgggaggctgattttactatgcctgcagcagaaggagcccctcttgttccc
cgtccagcgactttgtctatcagcacggtacctgcagccagtactccgctttttaacaaa
tctttgagttgtagctcatctttggcatccatgaaccttgatggcagttcattggattct
gtgccaggtgaaaaaagaaaactccctgagagcttgactctggaggatgccaagcggatc
cgtgtgttaggagacatcccaatggaacttgttaacgaagtgatgttgacaatcacagat
ccagcagccatgctagggcctgagaccagtcttctgtcagcgaatgcagcccgggatgag
acggcccgacttgaggagcgtcgtggcataattgaattccatgtcatcggcaattcgctc
tcacagaaatcaaacaagaagattctcatgtggctggttggcttgcagaatgttttttca
caccaactgcctcgaatgcccaaggaatacatcacccgcctggtttttgaccctaaacac
aagactttggctctgattaaggatggccgagtgatcggcggcatctgcttccggatgttt
cctacacaggggttcacagagattgtcttctgtgcagtgacatccaatgagcaagtcaag
ggctatgggacccacctgatgaatcacctaaaggagtaccacatcaagcacagcattctc
tacttcctcacctatgcggatgaatatgccattggctacttcaagaagcagggtttctcc
aaagacatcaaagtccccaagacacgatatgttggttatatcaaggactatgagggagcc
accttgatggagtgtgaactgaatccccggattccctatacagagctctcgcatatcata
aagaaacagaaggagatcatcaagaagctgattgaaaggaagcaggctcaaatccgcaaa
gtctacccgggcctcacttgcttcaaagaaggtgttcgccatatccccatcgaaagcatt
ccaggcatccgggaaacaggatggaagcccctgggaaaggagaaagggaaagagttcaag
gatccagatcagttgtataccaccttgaaaaacctccttgcacaaatcaagacccacccc
agcgcctggccattcatggaaccagtgaagaaatccgaggctccagactactatgagatt
attcgttttcctattgacctcaagacgatgaccgagcggcttaagaaccgctactatgtc
accaagaagctgttcattgctgacttgcagcgcatcatcaccaactgccgtgaatacaat
ccgcccgagagtgattactgcaagtgtgccaatacccttgaaaagttcttctacttcaag
ctcaaggaagggggactcattgacaagtag

DBGET integrated database retrieval system