KEGG   Anolis carolinensis (green anole): 100556199Help
Entry
100556199         CDS       T01608                                 

Definition
histone acetyltransferase KAT2A-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:acs04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 849 aa AA seqDB search
MRRGAPATGIGASAWLLSMRSGIHAPTPPRRVLGIMAEPEVSLQTSARTPQAAASSAATA
SSVTAPPASSGGGSGGSSSTSSSDPVRPGLSQQQRASQRKAHARSFPRAKKLEKLGVFSA
CKANDSCKCNGWKNPNPPTAPRMDLQQTVTNLSEPCRSCGHALADHVSHLENVSEDEINR
LLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSRPVVEGSLGSPPFEKPNI
EQGVLNFVQYKFSHLPPKERQTMFELSKMFLLCLNYWKLETPSQFRQRSQNDDVATYKVN
YTRWLCYCHVPQSCDSLPRYETTQVFGRNLLKSTFTVTRRQLLEKFRVEKDKLVPEKRTL
ILTHFPKFLSMLEEEIYGESSPIWEADFTMPAAEGAPLVPRPATLSISTVPAASTPLFNK
SLSCSSSLASMNLDGSSLDSVPGEKRKLPESLTLEDAKRIRVLGDIPMELVNEVMLTITD
PAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFS
HQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVK
GYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKTRYVGYIKDYEGA
TLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVRHIPIESI
PGIRETGWKPLGKEKGKEFKDPDQLYTTLKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEI
IRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPESDYCKCANTLEKFFYFK
LKEGGLIDK
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaggcgctccagccacaggcataggagcctccgcctggcttctgagcatgcgc
agtggcatccatgcgcccacgccgcctcggagggtcctgggcatcatggcggagccggag
gtttccttacagactagtgcccggaccccgcaggctgccgcatcctccgccgctaccgcc
tcttcagtcacagctccgcctgcgtcctccggaggcggatccggaggaagcagcagcacc
agcagcagcgatccggttcgcccgggattaagtcagcaacagcgcgcgagtcagcgcaaa
gcgcatgcgcggagcttcccgcgggcaaaaaagctggagaagctaggggtattttcagcg
tgcaaggctaatgactcttgcaaatgcaatggctggaagaacccaaaccctcccacagcc
ccccgaatggatctgcagcagacagtcaccaacctcagtgagccatgccgtagctgtggg
cacgctctagctgaccatgtgtctcacctggagaacgtgtctgaggatgagatcaatcgg
cttcttgggatggttgtggatgtggagaaccttttcatgtctgtgcacaaggaagaggac
accgacaccaagcaggtttatttctacctgttcaagctcctgagaaaatgcattctgcag
atgagccgcccagttgttgagggatctcttgggagccccccgtttgagaaaccaaatatt
gaacagggtgttttaaactttgtgcagtacaagttcagccacctgcctcccaaggagcgg
cagaccatgtttgagctctccaagatgtttctcttgtgcctaaattattggaagctggaa
acgccatcccagttccgccagcgctcacaaaacgatgacgtggcaacttacaaagtcaat
tatacccggtggctgtgctactgccatgttccccagagttgtgacagccttcctcgatat
gaaaccacccaggtctttgggcgcaacctgctcaagtccacctttacagtgactcgtcgg
cagctgctggagaaattcagagttgaaaaagacaagttggtgccagagaaacggactctc
atcctcacccatttccccaaatttctgtcaatgttggaggaagaaatctatggggagagt
tcaccaatctgggaggctgattttactatgcctgcagcagaaggagcccctcttgttccc
cgtccagcgactttgtctatcagcacggtacctgcagccagtactccgctttttaacaaa
tctttgagttgtagctcatctttggcatccatgaaccttgatggcagttcattggattct
gtgccaggtgaaaaaagaaaactccctgagagcttgactctggaggatgccaagcggatc
cgtgtgttaggagacatcccaatggaacttgttaacgaagtgatgttgacaatcacagat
ccagcagccatgctagggcctgagaccagtcttctgtcagcgaatgcagcccgggatgag
acggcccgacttgaggagcgtcgtggcataattgaattccatgtcatcggcaattcgctc
tcacagaaatcaaacaagaagattctcatgtggctggttggcttgcagaatgttttttca
caccaactgcctcgaatgcccaaggaatacatcacccgcctggtttttgaccctaaacac
aagactttggctctgattaaggatggccgagtgatcggcggcatctgcttccggatgttt
cctacacaggggttcacagagattgtcttctgtgcagtgacatccaatgagcaagtcaag
ggctatgggacccacctgatgaatcacctaaaggagtaccacatcaagcacagcattctc
tacttcctcacctatgcggatgaatatgccattggctacttcaagaagcagggtttctcc
aaagacatcaaagtccccaagacacgatatgttggttatatcaaggactatgagggagcc
accttgatggagtgtgaactgaatccccggattccctatacagagctctcgcatatcata
aagaaacagaaggagatcatcaagaagctgattgaaaggaagcaggctcaaatccgcaaa
gtctacccgggcctcacttgcttcaaagaaggtgttcgccatatccccatcgaaagcatt
ccaggcatccgggaaacaggatggaagcccctgggaaaggagaaagggaaagagttcaag
gatccagatcagttgtataccaccttgaaaaacctccttgcacaaatcaagacccacccc
agcgcctggccattcatggaaccagtgaagaaatccgaggctccagactactatgagatt
attcgttttcctattgacctcaagacgatgaccgagcggcttaagaaccgctactatgtc
accaagaagctgttcattgctgacttgcagcgcatcatcaccaactgccgtgaatacaat
ccgcccgagagtgattactgcaagtgtgccaatacccttgaaaagttcttctacttcaag
ctcaaggaagggggactcattgacaagtag

DBGET integrated database retrieval system