KEGG   Anolis carolinensis (green anole): 100556213Help
Entry
100556213         CDS       T01608                                 

Definition
inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100556213
  Energy metabolism
   00920 Sulfur metabolism
    100556213
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100556213
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100556213
    3.1.3.25  inositol-phosphate phosphatase
     100556213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 270 aa AA seqDB search
MSEGGWRRRSRRCPGEKLTRGDLASNRKLVRLLRGAFPSLKINSEEHLDGDDQEIISWDR
TIPEDIKKRVQPIFVPADSITVWIDPLDATQEYTENLRQYVTTMVCAAVNGKPVIGVIHK
PFTGYTAWAMVGGGANIKARSSYNEQAPTIIVSRSHEGKVKQVALQTFGNKTVVIKAGGS
GYKVLSLLDVPEADQEKADVYIHVTFIKKWDICAGNAVLRALGGHMTTLAGEEIDYTGSV
ANDGGLIASINMNHKALLEKLPVQDKTSQN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggagggtggcggcggaggagcaggaggtgcccaggcgagaagctcacccgc
ggggacctcgcctccaaccgcaagctcgtccgcctcctccgaggggccttcccctctctc
aagataaattctgaagaacatcttgatggagatgaccaagagatcatttcttgggatcgc
accattcctgaagatataaagaaacgagtccagcctatttttgtaccagcagatagcatt
acagtgtggattgacccattagacgcaactcaagaatatacagagaatcttcgccagtat
gtgactacaatggtgtgcgctgctgtgaatggaaagccagttataggagtaatacacaag
ccatttactggatatacagcctgggcaatggtgggcggaggagccaacatcaaggcacgg
tcttcctacaacgaacaggcgcccaccatcatcgtgtcccggtcccacgaagggaaagtg
aagcaagtcgctttgcagacctttggaaataagactgtggtcattaaagctggcggttca
ggatacaaggtcctgtccctcctggacgtccccgaggcagatcaggagaaagcggacgtc
tacatccacgtcaccttcatcaagaagtgggacatctgcgcgggcaacgcggtgctgaga
gccttggggggccacatgacgactctggcgggagaggagatcgactacacggggtccgtc
gccaacgacggcgggctcatcgccagcatcaacatgaaccacaaggccctgctcgagaag
ctccccgttcaggacaagacctcgcagaattga

DBGET integrated database retrieval system