KEGG   Anolis carolinensis (green anole): 100556290Help
Entry
100556290         CDS       T01608                                 

Gene name
chp1
Definition
(RefSeq) calcineurin like EF-hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
acs  Anolis carolinensis (green anole)
Brite
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100556290 (chp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST HTH_23
Motif
Other DBs
NCBI-GeneID: 100556290
NCBI-ProteinID: XP_003214591
Ensembl: ENSACAG00000003694
UniProt: G1KC63
Position
1
AA seq 195 aa AA seqDB search
MGSRASTLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKNKDQNGLEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFAEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccgggcgtccacgctgctgagggacgaggagatcgaggaaatcaagaaagag
acgggcttttctcatagtcagattactcgattgtatagtcggtttaccagcttggacaaa
ggagagaatggcactcttagccgggaagatttccagcgcattccagaactcgccatcaat
ccactgggggaccggatcatcaatgcattctttccagaaggagaagaccaagtgaatttc
cgtggattcatgaggacgttggcccactttcggcccattgaagataatgagaaaaacaaa
gaccagaatggactggagccacttaatagtcggagcaacaaattacactttgcatttcga
ctttatgatctggataaagatgacaagatttctcgagatgagctacttcaggtgttgaga
atgatggttggtgtaaacatctctgatgaacagctgggaagtattgctgacagaaccatt
caagaggctgatcaagatggtgacagtgcaatatcctttgcagagtttgttaaggttttg
gagaaggtggatgtagaacaaaaaatgagcattcgatttcttcactga

DBGET integrated database retrieval system