KEGG   Anolis carolinensis (green anole): 100556401Help
Entry
100556401         CDS       T01608                                 

Gene name
kat8
Definition
(RefSeq) lysine acetyltransferase 8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100556401 (kat8)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100556401 (kat8)
   HAT complexes
    NSL complex
     100556401 (kat8)
    MSL complex
     100556401 (kat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 474 aa AA seqDB search
MAAAARPSAGEAASAPDEGGGGGGGEEGGRESPPGLEPRREDEDEAPGSGGNANPNHPPS
SPGPREAEVAVEIGETYLCRRADGTWHSAEVIQSRINEQEAREEFYVHYVGFNRRLDEWV
DKNRLALTKTVKDAVQKNTDQYMNELSEQPERKITRNQKRKHDEINHVQKTYAEMDPTTA
ALEKEHEAITKVKYVDKIHIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKFEKTYR
YHLGQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFI
FYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLES
TVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLN
MVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSLCLRWAPPKHKQAKISKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggctgcgaggcccagcgccggcgaagcggcctcggctcccgatgaggggggc
ggcggaggaggaggagaagaaggcggcagggagagtcctcctggcttggagccgcgacgg
gaggacgaggacgaggcgccggggagcggcggcaacgccaaccccaaccacccgccctcg
tcgccggggccccgcgaagccgaggtcgccgtggagatcggggagacctacctgtgccgg
cgcgcggacgggacctggcattctgcagaggtgatccagtctcgaataaatgaacaagaa
gccagggaagaattttacgtgcactatgttggatttaaccgtcgcttggatgagtgggtg
gataaaaaccgcctggccctcaccaagacagtcaaagatgcggtgcagaagaacactgat
cagtacatgaatgaattgtctgagcagccagagcgcaaaatcactcgcaaccaaaagcgc
aaacacgatgaaatcaaccatgtgcaaaagacctatgctgagatggatcccaccactgca
gctttggaaaaggaacatgaagctatcaccaaggtgaaatatgtagacaagatccacatt
ggaaactttgagattgatgcatggtatttttcgccgttcccagaagactacggaaagcag
cccaagctgtggatctgcgagtactgcctcaagtacatgaagtttgagaagacttaccgc
taccatcttggacagtgccagtggcggcaacccccagggaaggagatctaccggaagaac
aatatttctgtgtatgaggtggatggcaaagaccacaagatttactgccagaatttgtgt
ctcttggccaaacttttcctagaccacaagactctctactttgatgtggaacccttcatc
ttctacatcctcaccgaggttgacagacaaggggcccatattgtgggctacttttccaag
gagaaagaatcgccagatggcaacaacgtggcctgcatcctcaccttaccaccataccag
aggcgtggttatggaaagttcctcattgctttcagctatgaactatcaaagttggaaagt
acagttggctccccagaaaagcccctttcggatctcggcaagctgagctaccgtagctac
tggtcgtgggtactgctggagatccttcgggatttccgggggacgctctccatcaaagat
ctcagccagatgacaagcatcacacaaaatgacatcatcagtactcttcaatcgctgaac
atggtgaagtactggaagggccagcatgtcatctgtgtcacccccaagctggttgaggag
cacctcaaaagcgcccagtacaagaagcctcccatcacagtggattctctctgtctcaga
tgggcacctcccaaacacaagcaggccaagatttccaagaagtga

DBGET integrated database retrieval system