KEGG   Anolis carolinensis (green anole): 100556523Help
Entry
100556523         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 33-like
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 897 aa AA seqDB search
MSALSNDCSHLESVGEITKEDLIQKSHGTCQDCKIKGPNLWACLENRCSYVGCGESHIDH
STIHSQETKHCLTVNLTTLRVWCYACSKEVFLDRKLRSHSLLQNVRLSHQAPDINMQDIR
LPSIPTLKIPLIATFDDLDIQVDEEDEFKARGLTGLKNIGNTCYMNAALQALSNCPPLTQ
FFLDCGNLARTDKKPAICRSYYKLMTELWHKSRPGAVVPTNLFQGIKTVNPAFRGYSQQD
AQEFLRCLMDLLHEELKEPVVTLEDTSPTIAEERGEDERSQSDGDSESCDNTDKEEAESW
SKPVIENLSEDAMLIEEEESVSKDHQNEKSLCTKMNPAGSVENIEKDINNLFEMAELLNN
QETVKVQIHSRYSDYVNDVHMNDVSAPQSFSSKDGSNARPSTSPPKSSSFWSGLAPSHKK
VPVASSSKKKKHKQYRSVISDIFDGTIVSSVQCLTCDRVSVTLETFQDLSLPIPGKEDLA
KLHSASHQTSLVKAGSCGEAYAPQGWIAFFVEYFKSWFWGPTVTLQDCLAAFFARDELKG
DNMYSCEKCKKLRNGVKFCKVQHFPEILCIHLKRFRHDLMFSTKIGTHVSFPLEGLDLQP
FLAKDSPAQIVMYDLLSVICHHGTAINGHYIAYCWNNLNNRWYEFDDQSVTEVTESTVQN
AEAYVLFYRKSNEEAKRERQKLSNLNVMEPSLLQFYISRQWLNKYRTFAEPGPISNNDFL
CIHGGVPPYKATSIEDLVVMLPQNIWDNLYSRYGGGPAVNHLYVCHTCQVEAEKIEKRRK
TELEMFIRLNKAFQEEDSPSIFYCISMQWFREWEGFVKAKDSDPPGPIDNAKIAVNKCGN
VVLKQGADSGQISEETWNFLQSIYGGGPEIVLRPPVAQSEPESLQSEDKIELETCAL
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctttaagcaatgattgctcacatttggaatctgttggtgaaatcactaaagaa
gacttaatacaaaaatctcatggcacttgccaagactgtaaaataaaaggaccaaatctt
tgggcatgtttagagaatcgatgctcatatgttggttgtggagaatcccatatagatcac
agcaccatacattctcaggaaacaaagcactgtctaacagttaatcttacgacattacgt
gtctggtgttatgcatgcagcaaagaagtgtttctagatagaaaactgagatcacattct
ttgctgcaaaatgtacgactgtctcaccaagctccagacatcaacatgcaggatattagg
ttgcctagcatcccaacactgaaaattcctctgattgcaacatttgatgacctagatata
caagtagatgaagaagatgaattcaaggcaagaggactgaccggtttgaaaaacattggg
aacacttgttacatgaatgcagctttacaagctctttcaaattgcccaccattgacacag
tttttccttgactgtggaaacttagctcggactgataagaaacctgctatatgcagaagt
tactacaagctcatgacagaactttggcataaaagcagacctggagctgttgtccctaca
aatttgttccaaggaatcaaaacagttaatccggcatttcgaggctattcccaacaggat
gcccaggaatttctgcgttgtttaatggatttgctacatgaagagttaaaagagcctgtt
gtcacactagaagatactagcccaacaattgcagaagagagaggagaagacgagaggagc
cagtcagatggagattctgagtcatgtgacaacactgacaaagaagaagctgaatcttgg
tcaaaacctgtgatagagaacctttcagaggatgcgatgttaattgaggaagaggaaagt
gtatctaaagaccatcagaatgagaaatccttgtgtaccaaaatgaacccagcaggttct
gtggaaaacatagaaaaagatataaacaatttatttgaaatggctgaacttttgaataac
caagaaacagtaaaagtgcaaatacacagcagatactcagattatgtcaatgatgttcat
atgaatgatgtgtcagctccacaaagtttttcttccaaggatggaagcaatgcacgacca
tcaaccagcccccctaaatcaagttccttctggtctgggctggcaccctcacacaaaaag
gttccagttgcatcatcctctaaaaagaagaaacataaacaatacaggagtgttatttca
gacatatttgatggaactattgtaagttcagtgcagtgtctgacctgtgatcgggtgtca
gttaccctggaaactttccaggatttatcattgcctattccaggtaaggaagaccttgct
aaactgcactctgcaagtcatcagacatctcttgtcaaagcagggtcatgtggtgaagca
tatgctcctcaaggatggatagctttttttgtggaatatttcaaaagctggttttggggc
ccaacagttaccttacaagattgcctcgctgccttttttgctagagatgaactgaaaggt
gacaatatgtacagctgtgaaaaatgtaaaaagttaagaaatggagtaaaattctgcaaa
gttcaacactttcctgagattttatgcattcatctcaagcgattcaggcatgaccttatg
ttttctacaaaaatcgggacccatgtgtcctttcccttggaagggcttgatcttcaacct
tttcttgctaaggatagtccagctcagatagtgatgtatgatctcctatcagtcatctgc
catcatggaactgccatcaatggccattatatagcttattgctggaacaacttaaataac
cgatggtatgaatttgatgatcagagcgtcactgaagtaacagaatctactgtccaaaat
gccgaagcatatgtcctcttctacagaaaaagcaacgaagaagccaaaagagagagacaa
aagctgtcaaatctaaatgtgatggaaccaagcctcctccaattttacatttcccgacag
tggctgaataaatacagaacttttgcagagccaggtcctatttcaaataacgatttcctc
tgcatacatggaggagttcctccatacaaggctacatctattgaggacctggtcgtaatg
ctgcctcagaacatctgggataacttgtatagcaggtatggcggaggaccagctgttaac
catctgtatgtttgccatacctgccaagtggaagcagagaaaatagagaaaagaagaaag
acagaactggaaatgtttattcggctcaataaggcattccaggaagaagattcgccgtcc
atattctattgtatcagtatgcagtggttcagagaatgggaggggtttgtgaaggccaag
gacagtgatcctccaggacccattgataatgccaaaattgctgtcaacaaatgtggtaat
gttgttctgaaacaaggagctgactccggacagatttctgaagaaacatggaattttcta
cagtcaatatatgggggaggaccagaaatcgtactaaggccaccagttgctcaaagtgaa
cctgaatcactacagagtgaagataagattgagttggaaacatgtgctctgtag

DBGET integrated database retrieval system