KEGG   Anolis carolinensis (green anole): 100556605Help
Entry
100556605         CDS       T01608                                 

Gene name
ncoa1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100556605 (ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1506 aa AA seqDB search
MSGLGNNSMDPANPDSQKRKGSPCDTLAQSNEKRRREQENKYLEELADLLSANIGEIDSL
SVKPDKCKILKKTVDQIQQMKRLEQEKTADDDVQKSDISSSSQGVIEKESLGPLLLEALD
GFFFVVNREGRIVFVSENVTSYLGYNQDELMNTSVYSILHVGDHAEFVKNLLPKSLVNGV
PWPQESTRRNSHTFNCRMLTRPPDESAAENQEARQRYEVMQCFTVSQPKLIKEEGEDLQS
CLICIARRLPRSTVPTTSESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQ
PQGREPSYAKQLFQEVMTRGTAFSPSYRFTLSDGTILSAHTKCRLCCPQSPEMQPFIMGI
HIIEREHGPLSPQDNTNSGMPVPRVNPALNPNISPGQGMPLSTPLPPTNNGNMLPSNPGH
PPGPGLHANSGGAAATGPAGFGCSPGSQMGPNVALSQGQAAPQNSSHAMNLSSSPMNSPG
VTPPQFMSPRHRVSPGLVHRPRVPSNPFSPTMPTTHSPVGMMGGCGVASAVGNRPYPGTP
LNSMQGLREGPSPPVGYSTPSPVLRQLSNQNSPSRMSMPPMKTEPKDSKEMGSIMCGMAH
SDSVSGDSKPLDSSLLHGGDRLSEGDSKCLQATSQKLVQLLATTAQEQLRHADADTSCKE
PLSCTGTSGTPSSGNPVGSACPSSHSSLTERHKILHRLLQEGSPSDINSLAMEHDKKDGV
AGGNTAAVAAQNQGPGTPDMRLEADAMKKKESKDHQLLRYLLDKDEKELASNPTLSLDDV
KVKENPEQLESCSITPKQEDVKLQPQGQFASDLDQILPSLEKAAQLPPGLCGSETAESGG
ISIKSEILTPSLQPTTTARTPSGMSSVNGGQGMQAGRSPYEICDPLEPVQPRTAPFPPMN
GSPHPGLPPELARGAMSGPTPYQPDTGLPELELGVTDHQFGQPTMGEQLPWADNAMTSIN
QGPISKPDDHCITSQLDELLCPPTTPEGRNDEKALLEQLVSFLSGKDENELAELDRALGI
DKLVQGGGLEALTERFQPQQAAPAPPPMAMDQKPSLYPQPYPSASPNANLAGPFQGMVRQ
KQSFGPMPVQVPPPRGGFPTNMGMQPRQALSRPPTAPNQLRLQLQQRLQGQQQLIHQNRQ
AILNQFAGNPPGSMGMRPSMQQQIAGQPPLNAQMLAQRQRELYSQQHRQRQLMQQRAMLM
RQQQSFGSSLPPSAGVPVPMGAGRLPQAPPQQFPFPPNYGTNPGNPPASTSPFSQLAASN
PEAALASRNNMVNRGMMGSVGGQFGTNMSPQMQQNIFQYSGSGMGQQGEAAFAPSLSPGS
PLMSPQIPPSQSPMLQSAPPTPGYQSPDMKTWQQGAMGNNSVFGQAGQSQPSPAQQGMYN
NMSITVSMAGGNANVQNMNPMAGQMPMSSLQMPGMNQLCPEQVNDPSLRPSGLYCNQLSS
DLLKTEADGAQVQQVQVFADVQCTVNLVGGDPYLNAPGPVGGQKTPGGSQTPQAQQKSLL
QQLLTE
NT seq 4521 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcgggaacaactccatggacccggcaaacccagattcccaaaagaggaag
gggtcgccatgtgacactctggcccagagcaatgagaaacggcgcagggaacaagagaac
aaatacctagaagaactcgcagacttgctttccgccaatattggagagatcgacagcctg
agcgtcaaacccgacaaatgcaagatcttgaagaaaaccgtcgatcagattcagcagatg
aagaggcttgagcaagaaaaaacagctgatgatgatgtccagaaatccgatatctcgtcc
agcagccaaggagtgattgagaaggaatccctcgggcctctccttctggaggcgcttgat
ggcttcttttttgtcgtgaatcgtgaaggacggatcgtgtttgtgtcagagaatgtgacc
agctacttgggctacaaccaggacgaactcatgaacaccagtgtctacagcatcttgcac
gtgggagaccatgctgagtttgtcaagaacctcttgcccaaatcgctcgtcaacggcgtc
ccttggccccaagaatccaccaggcgcaacagtcatactttcaactgcaggatgctgacc
cggccgccggatgaatccgccgcagagaaccaggaggcccgtcagcgctacgaggtcatg
cagtgcttcaccgtgtcccagccaaagctgatcaaggaggaaggagaagatctgcagtcc
tgcctgatatgcatcgcacgaagattacctcgatccactgtccccaccacatcagaatct
ttcatgaccaagcaagatactacaggtaaaatcatttccatcgacaccagttcgctgaga
gcagcaggccggaccggctgggaagatctagtgaggaaatgcatctatgctttcttccag
cctcagggcagggagccatcttacgccaagcagctatttcaggaagtgatgacgcggggc
acagccttcagcccatcctaccggttcacactaagcgacgggactatcctgagcgctcac
accaagtgcaggctctgctgcccgcagagcccagagatgcagcctttcatcatgggcatt
cacatcattgagagggaacatggcccactgtcacctcaagataacactaactctggaatg
cctgttccccgggtcaatcccgctctgaaccccaacatttccccggggcaaggtatgcct
ctgtctacaccgctccctcctaccaacaatggaaacatgttaccatccaatccgggccac
ccgccgggaccgggcctgcatgccaatagcgggggtgctgccgctaccggcccggcaggc
tttggatgttcaccggggagccagatgggaccgaacgttgccttaagccagggacaggct
gctccccagaacagtagccatgccatgaacctcagcagctccccaatgaacagtcccggg
gtcaccccgccacagttcatgtcccccaggcatcgggtcagcccaggactggtccatagg
cccagagtgccaagcaatcccttttcccccacgatgcccaccacacactcccccgtgggc
atgatgggtggctgcggtgtcgccagcgctgtcggcaacaggccttaccccggcaccccc
ttaaactccatgcagggactgagggaagggcccagccccccggtgggctactcgaccccc
tctcctgttttgcgacagctgagcaaccagaactcgcccagccggatgagcatgccgccc
atgaaaacggagccaaaggacagcaaggagatgggctccatcatgtgcggcatggctcat
tccgacagtgtctcgggggacagcaagcccttggactctagcttgctgcacggtggcgac
agactctcggagggggacagcaagtgcttacaggccaccagccagaagctagtccagctc
ctggctaccacggcccaggagcagttgcggcacgcagatgccgacaccagctgcaaagag
cctttgtcttgcacgggcacctccggcaccccctcctccgggaaccccgtgggcagcgcc
tgcccctcctctcacagctccctcactgagcggcacaagatcttgcaccggctcctccag
gagggcagcccctcggacattaactccctggccatggagcacgacaaaaaggacggcgtg
gccggcggaaacaccgcagccgtcgccgcacagaaccaaggcccagggaccccggacatg
aggctggaggccgacgcaatgaagaagaaggagtccaaggaccaccagctcctccgctac
cttcttgacaaggatgaaaaggagctggcgtctaaccccaccttgagcctggatgacgtg
aaggtgaaagagaatccggagcaactggaatcctgcagtataactcctaagcaggaggat
gtgaagctgcagccacagggacagtttgcctccgacctcgaccagatcttgccatcgctg
gaaaaagccgcccagttgccgccgggcctctgtggatcggagacggccgaaagcggtggc
atctccatcaagtccgagatcttgaccccttccctccagccgaccaccacagcgcgaact
cccagtgggatgagctcagtgaatggcggccaaggaatgcaggctggacggtctccttat
gaaatttgtgaccccttggagccggttcaacctcggacggcacccttcccacccatgaat
ggcagtcctcacccggggttgccccctgagctggccagaggggccatgtctggacccacc
ccttaccagcccgacacagggttgcctgaactggaattgggagtcaccgatcatcagttt
ggacagccaacaatgggagaacagctcccttgggcagacaacgccatgacctccatcaac
caaggacccataagcaagccagatgaccactgcatcacgtctcagctggacgagctcctg
tgccccccaaccacccccgaggggcggaacgacgagaaagccctcctcgagcagctggtc
tccttcctgagcggcaaagacgagaacgaactggcagaactggaccgcgctcttggcatc
gacaaactggtccagggaggtggcctagaagcgctgacagagaggttccagccacagcaa
gcggcgcctgccccaccacccatggccatggaccagaagcccagcttgtacccgcagcct
tacccctcggcctcccccaacgccaacctcgccggccccttccagggcatggtcaggcag
aagcagtcttttgggcccatgccggtccaggtcccgccgcctcgggggggcttcccgacc
aacatggggatgcagccacggcaggctctcagccggccccccacggcccccaaccagttg
cgcctgcagctgcaacagaggctccagggacaacagcagctgatacaccaaaatcggcaa
gcaatcctgaaccaatttgctgggaaccctccgggcagcatgggcatgaggcccagcatg
cagcaacaaattgcggggcagccgccgctcaacgcacaaatgctggcccagcgccagcgc
gaactctacagccagcagcaccggcagaggcaactcatgcagcagcgtgccatgctcatg
cggcaacagcagagcttcgggagcagcctccctccttcagccggggtcccggtgcccatg
ggggctgggcgcctcccccaggccccccctcagcagttccccttcccccccaactatggt
acgaatccagggaaccccccagcctccaccagccccttctcgcagctggcggcgtccaac
ccggaggcggctctggccagccggaacaacatggtgaacaggggcatgatggggagcgtc
gggggacagttcggcaccaacatgagccctcagatgcagcagaacatcttccagtattcg
gggtcagggatgggtcagcaaggggaggcagcctttgccccttcgctcagccctggcagc
cccttgatgtcgccccagatccctccctcacagagcccaatgctccagtcggccccaccc
acgccgggctaccagtcgcccgacatgaagacctggcagcaaggagccatggggaataac
agcgtctttggccaagctgggcagagccagccctcacccgcccagcagggaatgtacaac
aacatgagcatcaccgtctccatggctggagggaatgccaatgtccagaacatgaacccg
atggctgggcagatgcccatgagctccctgcagatgcctggcatgaaccagctgtgtcct
gagcaggtgaatgacccatctctcagaccctcaggcctctactgcaaccagctctcctct
gaccttttgaagacagaagctgatggcgcacaggtccagcaggtccaggtctttgcggac
gtccagtgcacggtcaacctggtgggcggagacccctacctgaatgcgcccggcccggtg
gggggccagaagaccccggggggctcccagacgccgcaggcccagcagaaaagcctcctt
cagcagctactgactgaatag

DBGET integrated database retrieval system