KEGG   Anolis carolinensis (green anole): 100556612Help
Entry
100556612         CDS       T01608                                 

Definition
histone deacetylase 8-like
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100556612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 370 aa AA seqDB search
MAAAPPPPPCYVYSPEYVARCDALCKVPRRASMVHSLIKAYSLLDHMRIVRPKVASMEEM
ATFHTDAYLHHLRKVSEEGDDDDPESVEYGLGYDCPTSEGIFDYAAAVGGATITAAQCLV
DGKCQVAINWHGGWHHAKKDEASGFCYLNDAVLGILQLRRKFERVLYVDLDLHHGDGVED
AFSFTSKVMTVSLHKFSPGFFPGTGDVTDVGLGKGRYYSVNVPIQDGIQDERYYQICETV
LKEVYAAFSPEAVVLQLGADTIAGDPMCSFNLTPEGIGKCLRYVLQWQRPTLVLGGGGYH
LANTVRCWTYLTAVILGRTLSSEIPDHEFFTEYGPDYVLEITPSCRPDRNEPKRIQEILN
CVKGNLKHVA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgctccgccgccgcctccctgctatgtttatagccccgaatacgtggcgcga
tgcgacgctctctgcaaagtgccccggagggccagcatggtgcactccctgatcaaggcc
tactcgctgctggatcacatgaggattgtccggcccaaagtggcctccatggaggagatg
gccaccttccacacagacgcctacctgcatcacctgcggaaggttagcgaagagggcgac
gacgatgacccggagtctgtggaatacggactgggttacgactgtccaaccagcgaaggg
atctttgactacgcagcagctgtaggaggggccactatcacagccgcccagtgcttagtg
gacgggaagtgccaggtggccatcaactggcatgggggctggcatcatgctaaaaaagat
gaagcttccggcttctgttacctgaacgatgctgtcctgggcattttgcagctgcggcgg
aagtttgagcgtgtcctgtacgtcgacctcgacctacatcatggggacggtgtagaagat
gccttcagcttcacctccaaggtcatgacagtgtctctgcataaattttcacctggtttt
ttcccaggaacgggagatgtgacggatgtgggcctggggaaggggcgctactacagcgtc
aacgtgcccatccaagatggcatacaggacgagcgatactaccaaatctgcgagacggtg
ctgaaggaagtctatgcagcatttagtcctgaggctgtggtcctgcagttgggggcagac
accattgccggggaccccatgtgctccttcaacctgacccccgaagggattggcaagtgc
ctgcggtacgtcttgcaatggcagcgcccaaccctcgtcctgggaggagggggctaccat
cttgccaacacggtccggtgctggacctacttgactgcagtcattctagggagaacgtta
tcctcagagatcccggatcatgagttcttcacagaatacggcccagattatgtgttggag
atcacaccaagttgcagacctgaccgcaatgaaccgaagagaatccaggaaatcctcaac
tgtgtaaaagggaacctgaaacatgtggcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system