KEGG   Anolis carolinensis (green anole): 100556629Help
Entry
100556629         CDS       T01608                                 

Gene name
map2k4
Definition
mitogen-activated protein kinase kinase 4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100556629 (map2k4)
   04012 ErbB signaling pathway
    100556629 (map2k4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100556629 (map2k4)
  Endocrine system
   04912 GnRH signaling pathway
    100556629 (map2k4)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100556629 (map2k4)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100556629 (map2k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 429 aa AA seqDB search
MAAPGPGPGPGSGPQAAAHTTVSSMQGFQINFCEKAQSKRRALKLNFANPPFKSTARFTL
NPGVPFQNPHIDTQATMGSNHIAPFTFKRREAEMIVKLSSRLQERLRTHSIESSGKLKIS
PEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLD
VVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDIIPEEILGKITL
ATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYM
APERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSN
SDEREFSHSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERTVDVACYVCKILDQMPA
TPSSPMYVD
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcccggtcctggccctggccctggctccgggccccaagcggcggcgcacacc
accgtcagcagcatgcagggctttcagataaacttctgtgaaaaagcacaaagtaagcgc
agagcactgaagctgaattttgcaaacccacctttcaaatccacagcacgatttacttta
aaccccggagttccttttcagaatccacacattgatactcaagcaacaatgggtagtaat
cacattgccccgttcactttcaaaaggagagaagcggagatgatcgtgaaactttccagc
aggctacaagaaagactgagaacacacagcattgaatcatcgggaaagttgaagatttcc
cctgaacagcattgggactttacggcagaggacctgaaagaccttggagaaattggacga
ggagcttatggttctgtcaacaaaatggtccacaaaccaagtggacaaattatggctgtt
aaaagaattcggtcaacagtggatgaaaaggaacagaaacagcttttaatggatctggac
gtagttatgcgaagcagtgactgcccatatattgttcagttttatggagcactattcaga
gagggtgactgttggatctgtatggagctcatgtctacctcgtttgataaattttacaaa
tatgtatatagtgtattagatgacattattccagaagaaattctaggcaaaatcacttta
gctactgtgaaagcactaaaccacttaaaagaaaacttgaaaatcattcacagagatatt
aaaccttccaatattcttctggacagaaatggaaatattaaactctgtgatttcggcatc
agcggacaacttgtagactctattgccaaaaccagagatgcagggtgtcggccgtacatg
gcaccagaaaggatagaccccagtgcatccaggcaaggttacgatgtccgctccgatgtc
tggagcttagggattacattgtatgagctggccaccggacggttcccctatcccaaatgg
aatagtgtatttgatcaactgacacaagtagtcaaaggagacccacctcagctgagtaat
tcagatgaacgggagttctcccacagttttataaactttgtcaacttgtgccttacaaag
gacgagtccaaacggccaaagtataaggagcttctgaaacatcccttcattctaatgtat
gaggagcgaacggtagatgttgcgtgctatgtttgtaaaatcctggatcaaatgccagca
actcccagctctcccatgtatgttgattga

DBGET integrated database retrieval system