KEGG   Anolis carolinensis (green anole): 100556736Help
Entry
100556736         CDS       T01608                                 

Gene name
usp34
Definition
(RefSeq) ubiquitin specific peptidase 34
  KO
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100556736 (usp34)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100556736 (usp34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 3560 aa AA seqDB search
MCESCAELLEVLNEISDIEGGDGLQLRKEHALKVFAYINSWTQRQCLCCFKEYKHLEIFN
QVVCALINLVIAQVQALRDQLCKHCTINLDSTWQDENNPSDEPLNVERESHGEEENGEIH
KSIEKKIDSGRTCILTEDESTKGTDAFSIWSTEEKEKLLLCVAKIFQIQFPLYTAYKHNT
HPTIEDISAQESNILGAFCDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPF
LIAHAFITVVSNIRIWLHIPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWST
VKEPLDTALCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTET
SIAKELADWLINNNVVEHIFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLK
HCSRYIHDLFPSLIKNLDPVPLRHLLNLVSTLHPSAHTEQTLYLSSMLIKALWNNALAAK
AQLSKQSSFASLLSTNLPMGNKKEEEDLRRAAPSPWSPAASPQSSDNSDTHQSGGSDIEM
EEQLISRNKHVQQRLSDTEESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEANSSHAS
QSAGSPGSEVQSEDIADIEALKEEEEEEEEERSHNSQKNGRSAELRSRKMESQSGICLGE
AQASAERSGVSNGTGNDHVFNTDSLPPVDNRIRMLDPCSHTEDTDHDMTGEMSATHISQG
SQDSCITHTGDFLGEAIGNELFNCRQFIGPQHHHHHHHHHHHHHHHHHEGHMVDDMLSAD
DVSCSSSQVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLS
QGPAVHKHQYNSNAVTDINLDNVCKKGNTLLWDLVQDEDAIHLSEGLINEAEKLLCSLVC
WFTDRQIRMRFIEGCLENLANNRSVVVSLRLLPKLFGTFQQFGSSYDTHWITMWAEKELN
MMKLFFDNLVYYIQAVREGRHKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVD
ILWHCLVEDSECYDDALHWFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNL
FQHLCNLARLATSAYDGGTNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGL
EKEQEFISKCMESLMIASSNLEQDSHSSLTIIERGLLMLKTHLEAFRRRFAYHLRQWQIE
GTGISSHLKALSDKQSLPLRIVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQ
LNQQAHLQEFGQSSRKGDFPGGLMGPVRMISSGHELTTDYDEKTLHELGFKDMQMVFVSL
GAPRRERKGEGVQLPASCLPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPPAEVAM
EDSESAKCEELHLHAENLSRRVWELLMLLPTCPNMLQAFQNISDEQSNDVFNWKDLLRIK
SAHKLLYALEIIEALGKPNRRIRRESTGSYSDLYPDSDDSSEDQIENSKNTWSCKFVASG
GLQQLLEIFNSGILEPKEQESWTVWLLDCLACLLKLICQFAVDPSDLDLAYHDVFAWSGV
AENHRKRTWPGKSRKTASDHTKGLHIPRLTEVFLVLVQGTSLIQRLMCVAYTYDNLAPRV
LKAQADHRSRHEVTHYSMWLLVSWAHCCSLVKSSLADSDNLQDWLRKLTLLIPETAVRHE
SCNGLYKLSLSGLDGGDSINRSFLLLAASTLLKFLPDAQALKPIKIEDYEEEPILQPGCK
EYFWLLCKLIDNIHVKDASQTTLLDLDALARHLADCIRSREILDHQDGNIEDDGLTGLLR
LATSVVKHKPPFKFSREGQEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMV
KGSVENYRLLHNWVMAQHMQSSHAPYKWDYWPHDDVRAECRFVGLTNLGATCYLASTIQQ
LYMIPEARQAIFTAKYSEDMKHKTTLLELQKMFTHLMESECKAYNPRPFCKTYTMDKQPL
NTGEQKDMTEFFTDLITKIEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTV
RCQVADMKNIYESLDEVTIKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRY
TFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSDRKEGFKDDGNGSKEARSYEYDLI
GVTVHTGTADGGHYYSFIRDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTK
TYDSVTDKFMDFSFEKTHSAYMLFYKRMEPEEENGKEYKFDVSSELLEWIWHDNMQFLQD
KNIFEHTYFGFMWQLCSSIPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIEL
LTKQFNNSQAACEWFLDRMADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHL
YLQPGIEDCSDDMDGPVEDIGSRSCVTRFVKTLLSIMEHGVKPHSKHLTEYFAFLYEFAK
MGEEESQFLLSLQAISTMVHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRP
AALEKMIALIALLVEQSRSERHLTLSQNDMAALTGGKGFPFLFQHIRDGINIRQTCNLIF
SLCRYNNRLAEHIVSMLFTSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQRI
WEVIEYNPSQCLDWLAVQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSL
IPSNSFRQMFRSTRSLHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTK
LVPYFSFMTYCLISKTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCVD
CPENVRLIVQNPVVTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQ
LASHQNIQWAFKNLTPHASQYPGAVEELFNLMQLFVAQRPDMREEELEDIKQFKKTTISC
YLRCLDGRSCWTTLISAFRILLETDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVT
GDLVELLSIFLSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACI
DVLKELVLLSPHDFLHTLVPFLQHNHCTYHHSNIPMSLGPYFPCRENLKLIGGKSNIRPP
RPELNMCLLPTMVEANKGKDEVYDRMLLDYFFSYHQFIHLLCRVAINCEKFTETLVKMSV
LVAYEGLPLHLALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNN
VVYTFLTHFLLKVQGQVFSEANCAGVINNLVTNLINQYQSLESDFANQRVEIFKASSTLN
GDLRALALLLSVHTPKQLNAALIPTLQELLNKCRTCQQQKNLLQEQEAKERKTKDDEGAT
PVKRRRVSSDEEHTVDSCISDLKAEPREALTPTSTSDNETRDSSIIDPGTEQDLPSPENS
SVKEYRMEVPSSFSEDVMLAARSQHGEEQPSDGGRFEECKDPKEPASTKDTNLVEEEAEF
PSTSISAVLSDLTDLKSCEGHQALQDPDPGLSLGCSHSRGLLSHAQQQQQQDILDILCRT
IESTIHMLTRISGKGNQAAS
NT seq 10683 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagagctgcgccgagctgctggaggtgctgaacgagatatctgacatcgaaggt
ggtgatggattgcagctcagaaaagaacatgcgctcaaggtttttgcttatatcaattct
tggacgcaaaggcaatgtttgtgctgtttcaaggaatataagcatttggagatcttcaac
caagttgtgtgcgcgcttataaatttggtgattgcccaggttcaagctcttcgggaccag
ctgtgtaaacattgcactattaatttagactccacatggcaagatgagaataatccatct
gatgagccactgaatgtagaaagagaatctcatggagaggaagaaaatggtgaaatacac
aaatctatagagaaaaaaatagactctggacgaacttgtatcctgacagaagatgaatcc
acaaagggcactgatgcatttagcatatggagcaccgaggagaaggaaaaacttttgctt
tgcgtagcaaaaatctttcagatccagtttcctctgtatactgcttacaagcataataca
catcccacaatagaggatatttctgcacaagaaagcaatatattaggggcattctgtgat
atgaatgatgtagaagtaccattgcacttgcttcgttatgtttgcctattttgtggaaaa
aatggcctttccctcatgaaggactgttttgaatatggaacccccgaaacgttaccattt
ctcatagcacatgcatttatcactgtggtctccaatatcagaatatggctgcacatccct
gctgttatgcaacacataataccgttcagaacctatgttataagatatttatgtaagctg
tcagaccaggaattaagacagagcgcagctcgtaatatggcagacttaatgtggagcaca
gttaaggagccattggatacagccttgtgttttgataaagagagtcttgatcttgcattt
aagtactttatgtcaccaactttaaccatgagattggccggactcagtcaaataacaaac
caactccatactttcaatgatgtttgtaataatgaatctttggtttcagatacagaaact
tccattgcaaaagagcttgcagactggctgatcaacaacaatgtggtagaacatattttt
ggaccaaatttacatattgagatcattaaacagtgccaagtgatccttaattttcttgct
gctgaaggacggcttagtacacagcatatagactgcatttgggctgcagcacagttgaag
cattgcagtcgctatatacatgacttgtttccttcacttatcaagaatttggatcctgtt
ccactcaggcatcttcttaatttagtctcaaccttgcatccaagtgctcacactgaacag
actttatatttgtcatctatgctcattaaagcattgtggaataatgcactagcagctaaa
gcccagctatcaaaacagagctcatttgcttctttgcttagtacaaacctaccaatggga
aataaaaaagaagaagaagatctcagaagagcagctccatcaccatggtcacctgcggca
agtcctcaaagtagtgacaacagtgatactcatcagagtggaggaagtgacattgaaatg
gaagagcagctgattagtagaaataaacatgttcagcagcggctttcagatacagaggaa
tcaatgcaaggaagctctgatgagacagcaaatagtggtgaagatggcagcagtgggcca
ggaagcagcagcggccacagtgatgggtccagcaacgaggccaactccagccatgcaagc
caatctgcagggagcccaggcagtgaggtgcagtcagaggacattgctgatattgaagct
ctcaaggaggaggaggaggaggaggaggaagagcggagtcataactcccagaaaaatggt
cgaagtgcagaattgcgaagccgaaaaatggaatctcagtcaggcatttgcttgggagaa
gctcaggcatcagcagagagaagcggtgtaagcaatggaactggaaatgaccacgttttt
aatactgactctttaccaccagtggataaccggattagaatgctagacccttgttcacac
acagaggacacagaccacgatatgactggagaaatgagtgcaactcacatatcacaaggt
tctcaagattcctgcataacacatacaggggactttctcggggaagcaattggaaatgaa
ttatttaactgccgtcagtttattgggccacagcatcatcaccatcatcatcaccaccac
caccatcatcaccaccaccatcacgaaggacacatggtagatgacatgttaagtgcagat
gatgtcagttgtagcagttcccaagtcagtgcaaaatcagagaaaaatatggcagatttt
gatggagaagaatctggctgtgaagaagaactggtacagattaattcacatgctgaactg
acatctcatcttcagcagcaccttccaaatcttgcatctatttatcatgagcatctgagc
caagggccagcagttcataagcaccagtacaacagcaacgcagtgacagatattaacttg
gataatgtttgtaagaagggcaatacccttttgtgggatctggtccaggatgaagatgca
attcatctctctgaaggtttgataaatgaagcagagaagcttttgtgttccttagtatgt
tggtttactgatagacaaattcggatgaggttcattgaaggctgtcttgaaaatttagca
aataacaggtcagttgtagtttctcttcgccttcttccaaagttatttggtacatttcaa
caatttgggagcagttatgacacacattggataacaatgtgggctgagaaagaactcaat
atgatgaagcttttctttgataatttggtatactacattcaagctgtaagggaaggacgg
cataaacatgcattgtacagccacagcgccgaagttcaggtgcgcctccaatttttgacg
tgtgttttttcaactctgggatcaccagatcactttaggttgagtctggaacaagtagac
atactgtggcattgtttggtagaagattctgaatgctatgatgatgctctccattggttc
ttaaatcaagtacgaagtaaagaccagcatgccatgggaatggaaacctacaagcatctt
tttttagaaaagatgcctcagctgaaacctgaaacaattagtatgactggattaaacttg
tttcagcatttatgtaatttggctcgtttggctactagtgcatatgatggcgggacaaac
tcagagttgtgtggcatggaccagttctggggtattgctttaagagcacagtctggagac
gtgagccgtgcagctatacagtatattaactcctattatattaatggaaaaacaggtctg
gagaaagagcaagaatttattagcaagtgcatggaaagcctgatgattgcatccagtaat
ctcgagcaagattctcactcaagtctcaccattattgaacgaggacttctgatgcttaaa
actcatttagaagcttttcggagaaggtttgcttatcatctaaggcagtggcaaattgaa
ggcactggcatcagtagccatttaaaagcactgagtgacaaacagtcactccctctcaga
atagtttgccaaccagctgggcttcctgacaagatgacaattgaaatgtatccaagtgat
caagtggctgatctaagggcagaagtaactcattggtatgagaacttgcagaaggaacaa
ttaaatcaacaagctcatctgcaagagttcggacaaagtagtagaaaaggagactttcca
gggggtctcatgggacctgtgagaatgatctcctctgggcatgaactaacaactgactac
gatgaaaaaactcttcatgaattggggtttaaagatatgcagatggtgtttgtgtccttg
ggtgctccaaggagggagcgaaagggagaaggcgtccaacttcctgcgtcctgcctgcct
cctcctcagaaagacaacattccaatgctcttgcttctgcaagagcctcatcttaccact
ctctttgatttgttagagatgcttgcctcatttaaacctcctccagcagaagtggctatg
gaagacagtgagagtgcaaaatgtgaagaactccatcttcatgcagaaaatctgtcaaga
cgagtctgggagttgttaatgcttctgcctacatgccccaatatgctccaggcatttcag
aatatttcagatgaacagagtaatgatgttttcaactggaaagatcttctgagaatcaaa
agcgcccataaacttctgtatgcccttgaaatcattgaagcccttggaaaacctaacaga
aggataaggagggaatccacgggaagttacagtgatttgtatccagattctgatgattca
agtgaagatcaaatagaaaacagtaaaaacacatggagctgcaagtttgtggcttcagga
gggcttcagcagctcttggaaatctttaactctgggattttggaacccaaagaacaggaa
tcatggactgtgtggttactagattgtcttgcttgtttgctgaagttgatatgccagttt
gccgtagacccttcagatctggatctggcatatcatgatgtctttgcctggtctggagtg
gcagagaaccaccgaaaaagaacttggccaggaaagtcacggaagacggcgagcgatcat
acaaaaggccttcacataccccgtctgacagaggtatttcttgtacttgtccagggaacc
agtttgattcagcgacttatgtgtgttgcttatacgtatgacaacttggcgcctagggtg
ttgaaagctcaagctgatcataggtcaagacatgaagttactcactattcaatgtggctt
ttagtgagttgggctcactgttgctctttagtgaaatccagcctagcagatagtgataat
ttgcaagactggctaaggaaactcactcttctcattcctgagactgcagtccgccatgag
tcttgcaatggcctttataaattgtcgttgtctgggctggatggtggggattccataaac
aggtccttcctgctgttggctgcctcaacattgctgaagtttcttcctgatgcccaggca
ttgaagcctatcaagattgaagattatgaagaagaacccatcttacagcctggctgtaag
gaatatttctggttgctatgcaaactaatagataatatacatgtaaaagatgctagtcag
acaacattgcttgatctagatgccttagctagacatttggctgattgtattcgaagcaga
gaaatccttgatcatcaggatggtaatatagaagatgatggtcttacaggtctcttacgc
ctggcaacaagtgttgtcaaacacaaaccaccttttaaattttccagagaaggacaggag
ttcctgagagatatctttaatcttctgttcttgttgccaagtctaaaagacagacaacaa
ccaaaatgcaagtcacattcttcaagggctgctgcttatgacttgttggttgaaatggtt
aagggttctgtagagaactacaggctgctccacaactgggttatggcacaacacatgcaa
tcttcccatgcaccttacaagtgggattattggcctcacgatgatgtcagagctgaatgc
aggtttgtgggactcaccaatcttggagcaacttgttacttggcatcaactattcaacaa
ttgtatatgattccagaagctaggcaagccatctttactgcaaagtattctgaggatatg
aagcacaagaccactttgttggaacttcaaaaaatgtttacacacttaatggaaagtgaa
tgcaaagcatacaatccaaggccattttgcaaaacatataccatggataagcagccactt
aatactggtgaacaaaaagacatgacagaattttttacagatctaataacaaaaattgaa
gaaatgtctccagagctgaaaaatacagtgaaaagcttatttggaggtgttatcaccaac
aatgttgtttctttggactgtgaacatgtcagccaaactgctgaagaattctacacagtg
agatgccaggtagcagacatgaagaatatttatgaatcccttgatgaagttacgattaaa
gatactctagaaggtgacaacatgtacacttgttctcattgtgggaagaaagtacgggct
gaaaaaagggcatgttttaagaaactgcctcgcatcttgagcttcaataccatgaggtat
acttttaacatggtcactatgatgaaggagaaagtcaacacacacttctcattccctttg
cgcctggacatgacgccttacactgaagattttctgatgggaaaaagtgacaggaaggaa
ggcttcaaggatgatggcaatggttcaaaggaggccaggagttatgagtacgatttgata
ggtgtaaccgttcacacaggaacagcagatggggggcactactacagctttattcgagat
attgtgaatcctcatgcttacaaaaacaacaagtggtatctttttaatgatgctgaagta
aaaccatttgattctgctcaactggcttctgagtgttttggtggagaaatgacaacaaaa
acatatgattctgtcactgacaagtttatggatttctcctttgaaaagacacatagtgca
tacatgctgttttataaacggatggaaccagaagaagaaaatggcaaagaatacaaattt
gatgtttcatctgaactgttagagtggatatggcatgataacatgcagtttcttcaagac
aagaatatttttgaacatacatattttgggttcatgtggcagttgtgtagtagcatcccc
agcacattaccagatccaaaagcagtttctttaatgacagccaagttaagcacttctttt
gtcctagaaacatttattcattcaaaagaaaagcccacaatgcttcagtggatcgaactg
ttaaccaagcagtttaacaacagtcaagctgcttgtgagtggtttctggaccgtatggct
gacgatgattggtggcccatgcagattctaataaaatgtcccaatcagattgtaagacag
atgttccaacggttgtgtattcatgtgatccaacgactgaggccagttcatgctcacctt
tacctgcagcctggaatagaagactgttcggatgacatggatggtcctgtggaagatatt
ggtagtcgttcctgtgtaactcgctttgtgaagaccctgttgtcaattatggaacacggt
gttaaacctcacagtaaacatctcacggaatactttgcctttctttatgaatttgccaaa
atgggagaagaggagagccagtttttgctttcactacaagcaatatcaacaatggtacat
ttctacatggggaccaaaggacctgaaaatccacaagttgaagtgttatcagaagaagaa
ggagaggaggaagaggaggaggaagacattctgtctttggcagaagaaaaatataggcct
gctgcccttgagaaaatgattgctcttatagcacttcttgttgaacagtctcgctcagaa
aggcatttaactttatcccagaatgacatggcagcattaacaggaggcaaaggttttcct
ttcttgtttcaacatatccgtgatggaatcaacatcaggcagacctgcaatcttattttc
agcctttgtcggtacaataacagacttgcagaacatattgtatcaatgcttttcacttct
atagccaaattgactcctgaggcagccaatccttttttcaagttgttgaccatgcttatg
gaatttgctggcgggcctccgggaatgccaccctttgcttcttacattcttcaaaggata
tgggaggtaattgaatacaacccttctcagtgcctggattggttagccgtgcagacacct
cggaataagcttgcccacagttgggtgttgcagaatatggagaactgggtagaacgcttt
cttttggctcataactacccaagagtgagaacctctgcagcctaccttctggtctccctt
attccaagcaattcattccggcagatgttccgatctactcgctcgctgcacatcccgact
cgggaccttccccttagtccagatacaacggtcgtccttcaccaggtttataatgtactc
cttgggctactctcacgagcgaagctctacgtcgatgctgctgttcacgggactacaaag
ctggtgccctatttcagctttatgacttactgtttgatttccaaaactgaaaaactcatg
ttttctacctacttcatggatttgtggaaccttttccagcctaaactttctgagcccgcc
attgccaccaaccacaacaagcaggccttgctctctttctggtacaatgtctgtgtcgac
tgccctgagaatgtacgccttatagtgcagaaccccgtggtgaccaagaacattgccttc
aattacatcctggcggaccatgacgaccaggatgtggtcctttttaaccggggaatgctg
cccgcctactatggcattctgcggctttgctgtgagcagtcccctgcattcacccggcag
ctggcttctcatcagaatatccagtgggccttcaagaatctcacaccacatgccagccag
tatcctggggcagtggaagagctgtttaacctcatgcaactctttgtggctcagaggcca
gatatgagagaggaggaactggaagacattaagcaattcaagaaaactactataagttgt
taccttcgttgcttagatggacggtcatgctggactactttaataagtgccttccgaata
ttattagaaactgacgaggaccgccttcttgtcgtgtttaacagaggcttaattctgatg
actgagtccttcaacacattgcacatgatgtaccacgaagccaccgcttgccatgtaact
ggagacctggttgagcttttgtccatattcctttctgtcctcaagtccacccggccatat
ctgcaaagaaaagatgtgaaacaagctctaatccagtggcaagagcgaatagagtttgct
cataagctgttaactttgctaaattcatacagccctcctgaacttagaaacgcttgtata
gatgtcctcaaagagctggtcctcttaagccctcatgatttcctgcacaccctggttcca
tttctacagcacaaccattgcacataccaccacagcaacatcccaatgtctcttggccct
tattttccgtgccgtgaaaatctgaagctgataggaggcaaaagcaacatccgcccccct
cgccctgagctcaacatgtgcctcttgcccacgatggtcgaagcgaacaaggggaaagat
gaagtttatgaccgtatgctgctagattatttcttttcatatcatcagttcatccatctt
ctgtgccgagttgccatcaactgcgagaagttcacagaaaccttagtaaagatgagtgtc
cttgttgcatatgaaggtttgcctcttcatctcgctttgtttcccaaactttggactgag
ctttgccaaactcagtctgccatgtcaaagaactgcatcaaactcctgtgtgaagatccc
gtgtttgctgaatacattaagtgcattctaatggacgaaaggacctttctcaacaacaac
gttgtatataccttcttaactcatttccttctcaaggttcaagggcaggtgttctctgaa
gcaaattgtgcaggagtaatcaataatttggttacaaatctgatcaaccagtaccagagt
ctagaatcagattttgccaatcaacgagttgaaatttttaaagcaagttccactttaaat
ggggacctccgtgccctcgcgctgctgctttccgtgcacactcccaaacagctcaatgct
gccctaatcccgacgttgcaagaattgctaaacaaatgcaggacttgtcaacagcagaag
aatttgctgcaggaacaggaagccaaagaaaggaaaactaaagacgacgaaggagcgacc
ccagtcaagcggaggcgggtgagcagcgacgaggagcacacagttgacagctgcatcagc
gacctcaaagccgaacctcgggaggcgctgaccccaacgagcacctctgacaacgagacg
cgggactcctcaatcatcgacccgggcactgagcaggacctgccgtcccccgaaaacagt
tccgtgaaagagtatcggatggaggtcccctcgtcgttctccgaagacgtgatgctggcc
gcccgttcacagcatggagaggagcagccatctgatggcggtcggtttgaagaatgcaaa
gacccgaaggagccggcgagcaccaaggataccaacctggtggaagaggaggccgaattc
ccctccacgtcaatctccgccgtcctgtccgacctcacggatttgaaaagctgcgagggc
caccaggccttgcaggaccccgatcccggcctctcgctgggctgcagccattccagggga
ctcttgagccacgcgcagcagcagcagcagcaagacattttagacatcctctgcaggacc
atcgagtcgacgattcacatgctcacgaggatatcgggcaaaggaaaccaagctgcttct
tga

DBGET integrated database retrieval system