KEGG   Anolis carolinensis (green anole): 100556736Help
Entry
100556736         CDS       T01608                                 

Gene name
usp34
Definition
ubiquitin specific peptidase 34
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 3602 aa AA seqDB search
MCESCAELLEVLNEISFLYMDNPFFRRSSMLLPIKYLCLHSSCQNLTFLLKTMLNDLSDI
EGGDGLQLRKEHALKVFAYINSWTQRQCLCCFKEYKHLEIFNQVVCALINLVIAQVQALR
DQLCKHCTINLDSTWQDENNPSDEPLNVERESHGEEENGEIHKSIEKKIDSGRTCILTED
ESTKGTDAFSIWSTEEKEKLLLCVAKIFQIQFPLYTAYKHNTHPTIEDISAQESNILGAF
CDMNDVEVPLHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFLIAHAFITVVSNIRIWLH
IPAVMQHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTVKEPLDTALCFDKESLDL
AFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSIAKELADWLINNNVVEH
IFGPNLHIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKHCSRYIHDLFPSLIKNLD
PVPLRHLLNLVSTLHPSAHTEQTLYLSSMLIKALWNNALAAKAQLSKQSSFASLLSTNLP
MGNKKEEEDLRRAAPSPWSPAASPQSSDNSDTHQSGGSDIEMEEQLISRNKHVQQRLSDT
EESMQGSSDETANSGEDGSSGPGSSSGHSDGSSNEANSSHASQSAGSPGSEVQSEDIADI
EALKEEEEEEEEERSHNSQKNGRSAELRSRKMESQSGICLGEAQASAERSGVSNGTGNDH
VFNTDSLPPVDNRIRMLDPCSHTEDTDHDMTGEMSATHISQGSQDSCITHTGDFLGEAIG
NELFNCRQFIGPQHHHHHHHHHHHHHHHHHEGHMVDDMLSADDVSCSSSQVSAKSEKNMA
DFDGEESGCEEELVQINSHAELTSHLQQHLPNLASIYHEHLSQGPAVHKHQYNSNAVTDI
NLDNVCKKGNTLLWDLVQDEDAIHLSEGLINEAEKLLCSLVCWFTDRQIRMRFIEGCLEN
LANNRSVVVSLRLLPKLFGTFQQFGSSYDTHWITMWAEKELNMMKLFFDNLVYYIQAVRE
GRHKHALYSHSAEVQVRLQFLTCVFSTLGSPDHFRLSLEQVDILWHCLVEDSECYDDALH
WFLNQVRSKDQHAMGMETYKHLFLEKMPQLKPETISMTGLNLFQHLCNLARLATSAYDGG
TNSELCGMDQFWGIALRAQSGDVSRAAIQYINSYYINGKTGLEKEQEFISKCMESLMIAS
SNLEQDSHSSLTIIERGLLMLKTHLEAFRRRFAYHLRQWQIEGTGISSHLKALSDKQSLP
LRIVCQPAGLPDKMTIEMYPSDQVADLRAEVTHWYENLQKEQLNQQAHLQEFGQSSRKGD
FPGGLMGPVRMISSGHELTTDYDEKTLHELGFKDMQMVFVSLGAPRRERKGEGVQLPASC
LPPPQKDNIPMLLLLQEPHLTTLFDLLEMLASFKPPPAEVAMEDSESAKCEELHLHAENL
SRRVWELLMLLPTCPNMLQAFQNISDEQSNDVFNWKDLLRIKSAHKLLYALEIIEALGKP
NRRIRRESTGSYSDLYPDSDDSSEDQIENSKNTWSCKFVASGGLQQLLEIFNSGILEPKE
QESWTVWLLDCLACLLKLICQFAVDPSDLDLAYHDVFAWSGVAENHRKRTWPGKSRKTAS
DHTKGLHIPRLTEVFLVLVQGTSLIQRLMCVAYTYDNLAPRVLKAQADHRSRHEVTHYSM
WLLVSWAHCCSLVKSSLADSDNLQDWLRKLTLLIPETAVRHESCNGLYKLSLSGLDGGDS
INRSFLLLAASTLLKFLPDAQALKPIKIEDYEEEPILQPGCKEYFWLLCKLIDNIHVKDA
SQTTLLDLDALARHLADCIRSREILDHQDGNIEDDGLTGLLRLATSVVKHKPPFKFSREG
QEFLRDIFNLLFLLPSLKDRQQPKCKSHSSRAAAYDLLVEMVKGSVENYRLLHNWVMAQH
MQSSHAPYKWDYWPHDDVRAECRFVGLTNLGATCYLASTIQQLYMIPEARQAIFTAKYSE
DMKHKTTLLELQKMFTHLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITK
IEEMSPELKNTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVT
IKDTLEGDNMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSF
PLRLDMTPYTEDFLMGKSDRKEGFKDDGNGSKEARSYEYDLIGVTVHTGTADGGHYYSFI
RDIVNPHAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTH
SAYMLFYKRMEPEEENGKEYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSS
IPSTLPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDR
MADDDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGIEDCSDDMDGPVE
DIGSRSCVTRFVKTLLSIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTM
VHFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIALIALLVEQSR
SERHLTLSQNDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSMLF
TSIAKLTPEAANPFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLAVQ
TPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRSLHI
PTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYFSFMTYCLISKTEK
LMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCVDCPENVRLIVQNPVVTKNI
AFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFKNLTPHA
SQYPGAVEELFNLMQLFVAQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCWTTLISAF
RILLETDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLVELLSIFLSVLKSTR
PYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLLSPHDFLHTL
VPFLQHNHCTYHHSNIPMSLGPYFPCRENLKLIGGKSNIRPPRPELNMCLLPTMVEANKG
KDEVYDRMLLDYFFSYHQFIHLLCRVAINCEKFTETLVKMSVLVAYEGLPLHLALFPKLW
TELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNNVVYTFLTHFLLKVQGQVF
SEANCAGVINNLVTNLINQYQSLESDFANQRVEIFKASSTLNGDLRALALLLSVHTPKQL
NAALIPTLQELLNKCRTCQQQKNLLQEQEAKERKTKDDEGATPVKRRRVSSDEEHTVDSC
ISDLKAEPREALTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKEYRMEVPSSFSEDVM
LAARSQHGEEQPSDGGRFEECKDPKEPASTKDTNLVEEEAEFPSTSISAVLSDLTDLKSC
EGHQALQDPDPGLSLGCSHSRGLLSHAQQQQQQDILDILCRTIESTIHMLTRISGKGNQA
AS
NT seq 10809 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagagctgcgccgagctgctggaggtgctgaacgagatatctttcttgtacatg
gacaacccattctttcgaagatcttctatgttgcttcccattaagtacttatgcctacat
tcctcctgccagaatcttaccttcctactcaaaactatgctaaatgacttatctgacatc
gaaggtggtgatggattgcagctcagaaaagaacatgcgctcaaggtttttgcttatatc
aattcttggacgcaaaggcaatgtttgtgctgtttcaaggaatataagcatttggagatc
ttcaaccaagttgtgtgcgcgcttataaatttggtgattgcccaggttcaagctcttcgg
gaccagctgtgtaaacattgcactattaatttagactccacatggcaagatgagaataat
ccatctgatgagccactgaatgtagaaagagaatctcatggagaggaagaaaatggtgaa
atacacaaatctatagagaaaaaaatagactctggacgaacttgtatcctgacagaagat
gaatccacaaagggcactgatgcatttagcatatggagcaccgaggagaaggaaaaactt
ttgctttgcgtagcaaaaatctttcagatccagtttcctctgtatactgcttacaagcat
aatacacatcccacaatagaggatatttctgcacaagaaagcaatatattaggggcattc
tgtgatatgaatgatgtagaagtaccattgcacttgcttcgttatgtttgcctattttgt
ggaaaaaatggcctttccctcatgaaggactgttttgaatatggaacccccgaaacgtta
ccatttctcatagcacatgcatttatcactgtggtctccaatatcagaatatggctgcac
atccctgctgttatgcaacacataataccgttcagaacctatgttataagatatttatgt
aagctgtcagaccaggaattaagacagagcgcagctcgtaatatggcagacttaatgtgg
agcacagttaaggagccattggatacagccttgtgttttgataaagagagtcttgatctt
gcatttaagtactttatgtcaccaactttaaccatgagattggccggactcagtcaaata
acaaaccaactccatactttcaatgatgtttgtaataatgaatctttggtttcagataca
gaaacttccattgcaaaagagcttgcagactggctgatcaacaacaatgtggtagaacat
atttttggaccaaatttacatattgagatcattaaacagtgccaagtgatccttaatttt
cttgctgctgaaggacggcttagtacacagcatatagactgcatttgggctgcagcacag
ttgaagcattgcagtcgctatatacatgacttgtttccttcacttatcaagaatttggat
cctgttccactcaggcatcttcttaatttagtctcaaccttgcatccaagtgctcacact
gaacagactttatatttgtcatctatgctcattaaagcattgtggaataatgcactagca
gctaaagcccagctatcaaaacagagctcatttgcttctttgcttagtacaaacctacca
atgggaaataaaaaagaagaagaagatctcagaagagcagctccatcaccatggtcacct
gcggcaagtcctcaaagtagtgacaacagtgatactcatcagagtggaggaagtgacatt
gaaatggaagagcagctgattagtagaaataaacatgttcagcagcggctttcagataca
gaggaatcaatgcaaggaagctctgatgagacagcaaatagtggtgaagatggcagcagt
gggccaggaagcagcagcggccacagtgatgggtccagcaacgaggccaactccagccat
gcaagccaatctgcagggagcccaggcagtgaggtgcagtcagaggacattgctgatatt
gaagctctcaaggaggaggaggaggaggaggaggaagagcggagtcataactcccagaaa
aatggtcgaagtgcagaattgcgaagccgaaaaatggaatctcagtcaggcatttgcttg
ggagaagctcaggcatcagcagagagaagcggtgtaagcaatggaactggaaatgaccac
gtttttaatactgactctttaccaccagtggataaccggattagaatgctagacccttgt
tcacacacagaggacacagaccacgatatgactggagaaatgagtgcaactcacatatca
caaggttctcaagattcctgcataacacatacaggggactttctcggggaagcaattgga
aatgaattatttaactgccgtcagtttattgggccacagcatcatcaccatcatcatcac
caccaccaccatcatcaccaccaccatcacgaaggacacatggtagatgacatgttaagt
gcagatgatgtcagttgtagcagttcccaagtcagtgcaaaatcagagaaaaatatggca
gattttgatggagaagaatctggctgtgaagaagaactggtacagattaattcacatgct
gaactgacatctcatcttcagcagcaccttccaaatcttgcatctatttatcatgagcat
ctgagccaagggccagcagttcataagcaccagtacaacagcaacgcagtgacagatatt
aacttggataatgtttgtaagaagggcaatacccttttgtgggatctggtccaggatgaa
gatgcaattcatctctctgaaggtttgataaatgaagcagagaagcttttgtgttcctta
gtatgttggtttactgatagacaaattcggatgaggttcattgaaggctgtcttgaaaat
ttagcaaataacaggtcagttgtagtttctcttcgccttcttccaaagttatttggtaca
tttcaacaatttgggagcagttatgacacacattggataacaatgtgggctgagaaagaa
ctcaatatgatgaagcttttctttgataatttggtatactacattcaagctgtaagggaa
ggacggcataaacatgcattgtacagccacagcgccgaagttcaggtgcgcctccaattt
ttgacgtgtgttttttcaactctgggatcaccagatcactttaggttgagtctggaacaa
gtagacatactgtggcattgtttggtagaagattctgaatgctatgatgatgctctccat
tggttcttaaatcaagtacgaagtaaagaccagcatgccatgggaatggaaacctacaag
catctttttttagaaaagatgcctcagctgaaacctgaaacaattagtatgactggatta
aacttgtttcagcatttatgtaatttggctcgtttggctactagtgcatatgatggcggg
acaaactcagagttgtgtggcatggaccagttctggggtattgctttaagagcacagtct
ggagacgtgagccgtgcagctatacagtatattaactcctattatattaatggaaaaaca
ggtctggagaaagagcaagaatttattagcaagtgcatggaaagcctgatgattgcatcc
agtaatctcgagcaagattctcactcaagtctcaccattattgaacgaggacttctgatg
cttaaaactcatttagaagcttttcggagaaggtttgcttatcatctaaggcagtggcaa
attgaaggcactggcatcagtagccatttaaaagcactgagtgacaaacagtcactccct
ctcagaatagtttgccaaccagctgggcttcctgacaagatgacaattgaaatgtatcca
agtgatcaagtggctgatctaagggcagaagtaactcattggtatgagaacttgcagaag
gaacaattaaatcaacaagctcatctgcaagagttcggacaaagtagtagaaaaggagac
tttccagggggtctcatgggacctgtgagaatgatctcctctgggcatgaactaacaact
gactacgatgaaaaaactcttcatgaattggggtttaaagatatgcagatggtgtttgtg
tccttgggtgctccaaggagggagcgaaagggagaaggcgtccaacttcctgcgtcctgc
ctgcctcctcctcagaaagacaacattccaatgctcttgcttctgcaagagcctcatctt
accactctctttgatttgttagagatgcttgcctcatttaaacctcctccagcagaagtg
gctatggaagacagtgagagtgcaaaatgtgaagaactccatcttcatgcagaaaatctg
tcaagacgagtctgggagttgttaatgcttctgcctacatgccccaatatgctccaggca
tttcagaatatttcagatgaacagagtaatgatgttttcaactggaaagatcttctgaga
atcaaaagcgcccataaacttctgtatgcccttgaaatcattgaagcccttggaaaacct
aacagaaggataaggagggaatccacgggaagttacagtgatttgtatccagattctgat
gattcaagtgaagatcaaatagaaaacagtaaaaacacatggagctgcaagtttgtggct
tcaggagggcttcagcagctcttggaaatctttaactctgggattttggaacccaaagaa
caggaatcatggactgtgtggttactagattgtcttgcttgtttgctgaagttgatatgc
cagtttgccgtagacccttcagatctggatctggcatatcatgatgtctttgcctggtct
ggagtggcagagaaccaccgaaaaagaacttggccaggaaagtcacggaagacggcgagc
gatcatacaaaaggccttcacataccccgtctgacagaggtatttcttgtacttgtccag
ggaaccagtttgattcagcgacttatgtgtgttgcttatacgtatgacaacttggcgcct
agggtgttgaaagctcaagctgatcataggtcaagacatgaagttactcactattcaatg
tggcttttagtgagttgggctcactgttgctctttagtgaaatccagcctagcagatagt
gataatttgcaagactggctaaggaaactcactcttctcattcctgagactgcagtccgc
catgagtcttgcaatggcctttataaattgtcgttgtctgggctggatggtggggattcc
ataaacaggtccttcctgctgttggctgcctcaacattgctgaagtttcttcctgatgcc
caggcattgaagcctatcaagattgaagattatgaagaagaacccatcttacagcctggc
tgtaaggaatatttctggttgctatgcaaactaatagataatatacatgtaaaagatgct
agtcagacaacattgcttgatctagatgccttagctagacatttggctgattgtattcga
agcagagaaatccttgatcatcaggatggtaatatagaagatgatggtcttacaggtctc
ttacgcctggcaacaagtgttgtcaaacacaaaccaccttttaaattttccagagaagga
caggagttcctgagagatatctttaatcttctgttcttgttgccaagtctaaaagacaga
caacaaccaaaatgcaagtcacattcttcaagggctgctgcttatgacttgttggttgaa
atggttaagggttctgtagagaactacaggctgctccacaactgggttatggcacaacac
atgcaatcttcccatgcaccttacaagtgggattattggcctcacgatgatgtcagagct
gaatgcaggtttgtgggactcaccaatcttggagcaacttgttacttggcatcaactatt
caacaattgtatatgattccagaagctaggcaagccatctttactgcaaagtattctgag
gatatgaagcacaagaccactttgttggaacttcaaaaaatgtttacacacttaatggaa
agtgaatgcaaagcatacaatccaaggccattttgcaaaacatataccatggataagcag
ccacttaatactggtgaacaaaaagacatgacagaattttttacagatctaataacaaaa
attgaagaaatgtctccagagctgaaaaatacagtgaaaagcttatttggaggtgttatc
accaacaatgttgtttctttggactgtgaacatgtcagccaaactgctgaagaattctac
acagtgagatgccaggtagcagacatgaagaatatttatgaatcccttgatgaagttacg
attaaagatactctagaaggtgacaacatgtacacttgttctcattgtgggaagaaagta
cgggctgaaaaaagggcatgttttaagaaactgcctcgcatcttgagcttcaataccatg
aggtatacttttaacatggtcactatgatgaaggagaaagtcaacacacacttctcattc
cctttgcgcctggacatgacgccttacactgaagattttctgatgggaaaaagtgacagg
aaggaaggcttcaaggatgatggcaatggttcaaaggaggccaggagttatgagtacgat
ttgataggtgtaaccgttcacacaggaacagcagatggggggcactactacagctttatt
cgagatattgtgaatcctcatgcttacaaaaacaacaagtggtatctttttaatgatgct
gaagtaaaaccatttgattctgctcaactggcttctgagtgttttggtggagaaatgaca
acaaaaacatatgattctgtcactgacaagtttatggatttctcctttgaaaagacacat
agtgcatacatgctgttttataaacggatggaaccagaagaagaaaatggcaaagaatac
aaatttgatgtttcatctgaactgttagagtggatatggcatgataacatgcagtttctt
caagacaagaatatttttgaacatacatattttgggttcatgtggcagttgtgtagtagc
atccccagcacattaccagatccaaaagcagtttctttaatgacagccaagttaagcact
tcttttgtcctagaaacatttattcattcaaaagaaaagcccacaatgcttcagtggatc
gaactgttaaccaagcagtttaacaacagtcaagctgcttgtgagtggtttctggaccgt
atggctgacgatgattggtggcccatgcagattctaataaaatgtcccaatcagattgta
agacagatgttccaacggttgtgtattcatgtgatccaacgactgaggccagttcatgct
cacctttacctgcagcctggaatagaagactgttcggatgacatggatggtcctgtggaa
gatattggtagtcgttcctgtgtaactcgctttgtgaagaccctgttgtcaattatggaa
cacggtgttaaacctcacagtaaacatctcacggaatactttgcctttctttatgaattt
gccaaaatgggagaagaggagagccagtttttgctttcactacaagcaatatcaacaatg
gtacatttctacatggggaccaaaggacctgaaaatccacaagttgaagtgttatcagaa
gaagaaggagaggaggaagaggaggaggaagacattctgtctttggcagaagaaaaatat
aggcctgctgcccttgagaaaatgattgctcttatagcacttcttgttgaacagtctcgc
tcagaaaggcatttaactttatcccagaatgacatggcagcattaacaggaggcaaaggt
tttcctttcttgtttcaacatatccgtgatggaatcaacatcaggcagacctgcaatctt
attttcagcctttgtcggtacaataacagacttgcagaacatattgtatcaatgcttttc
acttctatagccaaattgactcctgaggcagccaatccttttttcaagttgttgaccatg
cttatggaatttgctggcgggcctccgggaatgccaccctttgcttcttacattcttcaa
aggatatgggaggtaattgaatacaacccttctcagtgcctggattggttagccgtgcag
acacctcggaataagcttgcccacagttgggtgttgcagaatatggagaactgggtagaa
cgctttcttttggctcataactacccaagagtgagaacctctgcagcctaccttctggtc
tcccttattccaagcaattcattccggcagatgttccgatctactcgctcgctgcacatc
ccgactcgggaccttccccttagtccagatacaacggtcgtccttcaccaggtttataat
gtactccttgggctactctcacgagcgaagctctacgtcgatgctgctgttcacgggact
acaaagctggtgccctatttcagctttatgacttactgtttgatttccaaaactgaaaaa
ctcatgttttctacctacttcatggatttgtggaaccttttccagcctaaactttctgag
cccgccattgccaccaaccacaacaagcaggccttgctctctttctggtacaatgtctgt
gtcgactgccctgagaatgtacgccttatagtgcagaaccccgtggtgaccaagaacatt
gccttcaattacatcctggcggaccatgacgaccaggatgtggtcctttttaaccgggga
atgctgcccgcctactatggcattctgcggctttgctgtgagcagtcccctgcattcacc
cggcagctggcttctcatcagaatatccagtgggccttcaagaatctcacaccacatgcc
agccagtatcctggggcagtggaagagctgtttaacctcatgcaactctttgtggctcag
aggccagatatgagagaggaggaactggaagacattaagcaattcaagaaaactactata
agttgttaccttcgttgcttagatggacggtcatgctggactactttaataagtgccttc
cgaatattattagaaactgacgaggaccgccttcttgtcgtgtttaacagaggcttaatt
ctgatgactgagtccttcaacacattgcacatgatgtaccacgaagccaccgcttgccat
gtaactggagacctggttgagcttttgtccatattcctttctgtcctcaagtccacccgg
ccatatctgcaaagaaaagatgtgaaacaagctctaatccagtggcaagagcgaatagag
tttgctcataagctgttaactttgctaaattcatacagccctcctgaacttagaaacgct
tgtatagatgtcctcaaagagctggtcctcttaagccctcatgatttcctgcacaccctg
gttccatttctacagcacaaccattgcacataccaccacagcaacatcccaatgtctctt
ggcccttattttccgtgccgtgaaaatctgaagctgataggaggcaaaagcaacatccgc
ccccctcgccctgagctcaacatgtgcctcttgcccacgatggtcgaagcgaacaagggg
aaagatgaagtttatgaccgtatgctgctagattatttcttttcatatcatcagttcatc
catcttctgtgccgagttgccatcaactgcgagaagttcacagaaaccttagtaaagatg
agtgtccttgttgcatatgaaggtttgcctcttcatctcgctttgtttcccaaactttgg
actgagctttgccaaactcagtctgccatgtcaaagaactgcatcaaactcctgtgtgaa
gatcccgtgtttgctgaatacattaagtgcattctaatggacgaaaggacctttctcaac
aacaacgttgtatataccttcttaactcatttccttctcaaggttcaagggcaggtgttc
tctgaagcaaattgtgcaggagtaatcaataatttggttacaaatctgatcaaccagtac
cagagtctagaatcagattttgccaatcaacgagttgaaatttttaaagcaagttccact
ttaaatggggacctccgtgccctcgcgctgctgctttccgtgcacactcccaaacagctc
aatgctgccctaatcccgacgttgcaagaattgctaaacaaatgcaggacttgtcaacag
cagaagaatttgctgcaggaacaggaagccaaagaaaggaaaactaaagacgacgaagga
gcgaccccagtcaagcggaggcgggtgagcagcgacgaggagcacacagttgacagctgc
atcagcgacctcaaagccgaacctcgggaggcgctgaccccaacgagcacctctgacaac
gagacgcgggactcctcaatcatcgacccgggcactgagcaggacctgccgtcccccgaa
aacagttccgtgaaagagtatcggatggaggtcccctcgtcgttctccgaagacgtgatg
ctggccgcccgttcacagcatggagaggagcagccatctgatggcggtcggtttgaagaa
tgcaaagacccgaaggagccggcgagcaccaaggataccaacctggtggaagaggaggcc
gaattcccctccacgtcaatctccgccgtcctgtccgacctcacggatttgaaaagctgc
gagggccaccaggccttgcaggaccccgatcccggcctctcgctgggctgcagccattcc
aggggactcttgagccacgcgcagcagcagcagcagcaagacattttagacatcctctgc
aggaccatcgagtcgacgattcacatgctcacgaggatatcgggcaaaggaaaccaagct
gcttcttga

DBGET integrated database retrieval system