KEGG   Anolis carolinensis (green anole): 100556848Help
Entry
100556848         CDS       T01608                                 

Definition
histone deacetylase 7-like
Orthology
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 931 aa AA seqDB search
MDLRIGQRLAKPGPDTALLALKQTQLQHQLFLASLHQQQVEQLTHPHLRVPMEPPSQEPV
PGKQEQELRLLLNKDKSKRSAVASMVVKQKLAEVILKKQQAALERTNAPAMSYRSLEPME
HETPVNPVLSSFFPPVSNSSGDSPEHFPLRKTASEPNLKLRYKAKKAGERRKNPLTRKES
APPSLRRRPPETIDSSPSSSSTPVSGCSSPNDSLVPEHGALPPAPGLMQEGDGDHRTLPG
LAHKVPVLTSTHAPVFLSTNLEQHDPGSPLSTRLQPVIILEPSLAHSPLVTVPGLGAVPF
HFSHSVVPPERLSVPIHKPLGRTRSEPLPPSSRAVQQQLAYQQHHTLFLERLKHQTPLGK
RMSKSEKPRLQQIPSSEDMEAEAGGDVSDLPASQVEPSSAGTGTKEAERSSRLGQPQEDH
IFHQTQYTWEKHQQRSQQHQLLQRQPAPDSLLIPAARGSHRPLSRAHSSPAPATASLPNQ
DTSSKALPLPVQEQSTKPRFTTGIVYDSVMLKHQCSCGDNSNHPEHAGRIQSIWSRLQER
GLRSQCECLRGRKATLEELQSVHTERHVLLYGTNPLSRLKLDNGKLAGILSQRMFVMLPC
GGVGVDSDTIWNELHSSNAARWAAGSVTELAFKVASRQLKNGFAVVRPPGHHADPSTAMG
FCFFNSVAIAARQLQQKGKINKILIVDWDVHHGNGTQQVFYRDPNVLYISLHRHDNGNFF
PGSGAADEVGSGAGEGFTVNVAWTGGLDPPMGDPEYLAAFRTVVMPIAREFCPDVVLVSA
GFDAAEGHPPPLGGYKVSPKCFGYMTQQLMNVAGGALVLALEGGHDLTAICDASEACVSA
LLGNELEPLPEDTLQQKPNTNAVHSLDTVIQVQSQYWSSVRRFASTVGYSFLEAQRHDTE
EVETVTALASLSVMAEKRQQDEPMEEEPMNQ
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaggattggacagcgccttgccaaacctggcccagatacggctttgctggcc
ctgaagcagacgcagctacagcaccagctttttctagcaagcttgcaccagcagcaagtg
gagcagctcacccatccacacctgcgggtgccaatggagccgccatctcaagaacccgtc
cctggaaagcaggagcaagaattgcgactcctcttgaataaagacaaaagcaagcgcagt
gctgtagcaagtatggttgtgaagcagaagttggcggaggtaatcctgaagaaacaacag
gctgctctggagaggaccaatgcccctgccatgtcttacaggtccttggagccaatggaa
cacgaaaccccagtcaaccctgtgctttccagtttcttccctcctgtctcaaacagttcc
ggggactctccagaacatttcccattacggaaaacagcatcggagcccaacctgaagctg
cgctataaggctaaaaaggctggcgagcggcgcaaaaacccactgacccgcaaggaaagt
gcacccccttccttgaggaggcgtcccccagaaaccattgattcatctcccagcagcagc
agcaccccagtctctggctgcagttcacccaatgacagccttgtgcctgaacacggggcc
cttccaccagcaccaggacttatgcaagagggagatggagatcacaggacactccctggc
cttgcacacaaggttcctgtcctcaccagcacccatgcgcctgtgtttctgtccaccaac
ttagagcaacatgaccctggaagtcccttatctactcgactccagcctgtgatcatccta
gagccttcactcgcccattctcctctggtgacagttccaggtctgggagcagtccccttt
cacttcagccattcggtggttcccccagagcggctctcggtgccaatccacaagcccttg
ggacgaacgcgctcagagcccctgccgcccagttccagagccgtacaacaacaactggcc
taccagcaacaccacacccttttcctcgagaggctgaaacaccagacacctttgggcaag
cgtatgtccaagagtgagaagcctcggttgcagcagatcccctcgtctgaagatatggaa
gcagaggcaggaggagatgtgagcgaccttcctgcaagccaagtggagccttcatcagca
ggaactggcactaaggaggcagaaaggagctctaggttgggtcagccgcaggaagatcat
atctttcatcagacccagtacacctgggagaagcaccaacagcgcagccagcagcaccag
ctccttcagaggcagcctgctcctgactcccttctgatccctgctgcccgtggaagccac
cggccactttccagagctcattcgtcaccagccccagccactgcatccctacccaaccag
gacacatcttccaaggccctgccactgccagtgcaagagcagtccaccaaaccacggttc
accacaggaattgtgtatgactctgtcatgctgaagcaccaatgctcctgcggggacaac
agcaaccaccctgagcatgctggccgcatccaaagcatctggtctcgcctgcaagaacgg
ggcttacgcagccagtgtgagtgcctccggggacgcaaggccactttggaggagctgcag
tctgttcacactgagcgtcatgtgctgctgtatggcaccaaccccctcagccgcctgaag
ctggacaatggaaaattggcaggaatcctgtcccagcggatgtttgtcatgctgccctgc
ggtggtgttggggtggatagcgacaccatttggaatgaactgcactccagcaacgcagca
cgatgggctgctgggagcgtcacagaactggcctttaaggtggccagtcggcaactgaag
aatggctttgcagtagtacggcctccaggacaccatgcagatccctcaacagccatgggt
ttctgtttcttcaattctgtggcaattgcagccaggcagctccagcagaaagggaaaatc
aataagattcttattgtagactgggatgttcaccatggcaatggaacacagcaggtgttt
taccgagacccaaatgtcctctatatctctctacatcggcatgacaatggtaacttcttc
cctggaagtggagcagctgatgaggtgggctctggtgctggtgagggcttcacggtcaac
gtcgcttggacaggtggccttgacccacccatgggagatccggagtacttagctgctttc
cggacagttgtgatgccaattgctcgtgagttctgccctgatgtggtgctggtgtctgca
ggctttgatgcagccgaaggtcatccccccccactcggtggctacaaagtttcacccaaa
tgttttggctacatgacccaacagctgatgaacgtggctggaggggcccttgttcttgcg
ctggaaggaggacatgatctgactgccatctgcgacgcctctgaagcatgtgtctctgcc
ctgctgggtaatgagttggaaccccttccagaggacactctacaacagaaacccaacaca
aatgcggtgcactcattggacactgtgattcaggtgcaaagccaatactggagctctgtg
cggcgctttgcctccaccgtgggctactcattcctggaagcccaacgccacgacacggaa
gaagtggagactgtgacagcactggcctcactttctgtgatggcagaaaaaaggcagcag
gatgagcctatggaagaagagcccatgaaccaatga

DBGET integrated database retrieval system