KEGG   Anolis carolinensis (green anole): 100556939Help
Entry
100556939         CDS       T01608                                 

Definition
apolipoprotein A-IV-like
Orthology
K08760  
apolipoprotein A-IV
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 425 aa AA seqDB search
MDGRLACKWSPISRAEEERELGDPAVLEEGIACFSIFSIIGLGSCLPKISTQPKATMFLK
GAAVFLGLLAIIPGAQAEVSADQVADVVWSYFSQLGNNAKEAVAGQIPTSTEISQKLNSL
FQDNLDTVSAYALELQKQVVPFAEQLHGRMAEDSQKLKEQLREELDQLRARITPRAEEVR
QQMTGAIQNLQAQLGPYAEELRSQVNRNAAELRQGLEPLAEEMRAKLQENVGDLHGALSP
YADRLQQRIEAQVGTLKAALDPYANKLKAEADRTLEELRAGLAPFAQDAQGQLNRQLEGL
SFQMQKGIEELRAKLSEGTLDLEAKLSPLAHELREKLQRASELRESLAPYLDGLGGQIEG
RIEEFRQAVGPHGESINRLLVQKVEEMRSSLEPYADQAGDHLGFLEKNLRDKLASFFEAL
KQKEN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggatggacgattggcctgcaaatggagtcccatctccagggcagaagaagagagagag
ctcggggacccggcggtgctagaagaaggcattgcttgttttagcatatttagtatcatc
ggtttgggcagttgtttaccaaagatctccacccaacccaaagccaccatgtttctgaag
ggagctgccgtcttccttggcctcttggccatcattccaggagcccaggccgaggtcagc
gctgaccaagtggcggatgtcgtctggagctacttctcgcagctgggcaacaacgccaag
gaggccgtggccggacagatccccacgtcaacagagatcagccagaagctcaactccctc
ttccaggacaacctggacacggtcagcgcctatgccctggagctgcagaagcaggtggtg
ccctttgccgagcagctccacggccgcatggcggaagactcccagaagctgaaggagcaa
ctacgagaggagctggaccagttgcgcgcccgcatcacgcctcgcgccgaagaggtccgg
cagcagatgaccggcgccatccagaacctgcaggcccagctcggcccgtacgccgaggag
ctgcgcagccaggtgaaccgcaacgcggccgagctgcgccaaggtctggagccgctggca
gaggagatgcgtgccaagctgcaggagaacgtgggcgacctccacggggccctctcccct
tacgccgaccggctgcagcagcgcatcgaggcgcaggtggggaccctgaaggccgcgctg
gacccctacgccaacaagctcaaggccgaggccgaccggaccttggaggagctgcgcgcc
ggcctggcgcccttcgcccaagacgcccaggggcagctcaaccgccagctggagggcctc
tccttccagatgcagaagggcattgaggagctgcgggccaagctctccgaagggaccctc
gacctggaggccaagctgagccccttggcccacgagctgcgggagaagctgcagcgcgcc
tctgagctgcgggagagcctggcgccctacctggacgggctgggcgggcagatcgagggc
cggatcgaggagttccgccaggcggtggggccccacggagagagcatcaaccggctcctg
gtgcagaaggtggaggagatgaggagcagcctggagccctacgccgaccaggccggggac
cacctgggcttcctggagaagaacctgagggacaagctggcctccttcttcgaggccctc
aagcagaaggagaactga

DBGET integrated database retrieval system