KEGG   Anolis carolinensis (green anole): 100556962Help
Entry
100556962         CDS       T01608                                 

Gene name
usp16
Definition
ubiquitin specific peptidase 16
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100556962 (usp16)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100556962 (usp16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 842 aa AA seqDB search
MGKKRTKGKNVQSDDLTDISEPVCKHLRKGLEQGHLKKVLQNVDWGSCQDCRISDNGTPE
KSEDEAEDKPSIWLCLKCGHRGCGRNSQEKHALKHYETPRSEPHCLVLNVDNWSVWCYLC
DNEVQYSTSSRLGQLVDYVRKQTCTNVQNKDGAISVSKDEETKPVENKKVKDHKNEEEKE
KKELLLKENKIHLNGHTEVTVKGLSNLGNTCFFNAVLQNLSQTPVLRELLKEVKMADYTI
TIEPPEFSITEPVVITLDQPRPLTLAMCDFLTDMQETKKGTVTPKELFSQVCKKAIRFKG
YQQQDSQELLRYLLDGMRTEEVQRICAGIFKALNNSADKENEELKKKIKEYEKRKITQTF
VDRIFGGELTSTIMCEECQTVSLVHESFLDLSLPVLNDQGAKKKTVEKRVKKLQENEMED
DADNIENDSYLKDREETPGTSKHLQKKAKKIAKKQAKNHRRQQKFQEKVIPLTDSCATEK
NETDHISSNGIEKAEINSEVASLKQEEKSLNSYEQSCVDQRDNINGHDITDTHNNNVNAE
DSGQLENNEVGTGIPSEGLVSVVECVNKFDNLSLEEDSTLPVEDEDDDEDEDCAANGFHK
LSLDEEPEDDTDSFSELHNSKLYQVVNEDPETAFCTLANREEINTEESSVLHCLYQFTHN
EKLCENNKLLCDVCTHKQLCGPKTTGKNVKKPVYTNAKKQMLISLAPPILTLHLKRFQQT
GYNLQKVNKHIKFPEVIDLAPFCSIKCKNVAEGSSRVLYSLYGIVEHSGTMRSGHYTAYV
KTRATTNQLSDLVLHGRIQHTDAETESSKGQWFHISDTRVQAVPVSKVLNAQAYLLFYER
LL
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacgaacaaaagggaaaaatgtacagtcggatgacttaacagacatatca
gaacctgtgtgcaaacaccttcgcaaaggcttggaacaaggccacctgaaaaaagtcttg
caaaatgtagactggggctcctgccaggattgccgaatatctgacaatgggacaccggag
aaatctgaagatgaagcagaagacaaaccatcgatatggttatgtctaaaatgtggccac
aggggctgtggcagaaattctcaagaaaaacatgctttaaagcattacgaaaccccaaga
tcagaacctcactgtttagttcttaatgtggataactggagtgtgtggtgctacttgtgt
gataatgaggtccagtacagtacttccagtcggttgggccaacttgtagattatgttaga
aagcaaacttgtacaaatgtccaaaataaagacggtgccatttcagtatctaaagatgaa
gaaaccaaaccagtagaaaacaaaaaagtaaaagatcacaaaaatgaggaagagaaggag
aaaaaggagcttttgctcaaagagaataagattcatttaaatggtcatacagaagtgaca
gtgaagggtctcagcaatcttggaaacacctgtttctttaacgccgttttacagaacctg
tcacagaccccagttctaagagaactcttgaaagaggttaaaatggctgattatacaatt
acaattgaacctccagaattttcaataacagaacctgtggtaattacacttgatcaacca
agacctcttactttagcaatgtgcgattttctgacagacatgcaagagacaaaaaaggga
accgtgactcctaaagagctcttctcccaggtctgtaaaaaagccatacggtttaaaggg
tatcagcaacaggacagccaggagctgcttcgttacttactggatggaatgcggacagaa
gaagttcaacgaatctgtgccggaatctttaaggcactgaataattcagctgacaaagaa
aatgaagagctaaaaaagaagatcaaagaatatgaaaagaggaagataacacagaccttt
gtggatcgcatttttggaggcgagctaacaagcacaattatgtgtgaggaatgccaaact
gtttcattagtgcatgagtcattccttgatctttcactcccagttttaaatgatcagggt
gctaagaaaaaaacagttgagaaaagagttaaaaagttacaggaaaatgagatggaagat
gatgcagacaacattgaaaatgactcttatttgaaggatcgagaggagactcctgggaca
agcaagcatcttcagaaaaaggcaaagaaaattgccaaaaagcaagcaaagaaccatcgt
cgtcagcaaaaatttcaagaaaaggtgatcccactaacagacagctgtgccactgaaaaa
aatgaaactgaccatattagtagcaatggaatagaaaaggctgagattaactctgaggtg
gcttctctgaagcaagaagaaaagtcattgaattcatatgaacagtcttgtgtggatcaa
agagacaatataaacgggcatgatataactgatacccataataataatgtaaatgcagag
gattctggccaactggaaaataacgaagttggtacgggcattccctcagaaggcttagtt
tctgttgtagagtgtgtcaataaatttgacaatctgtctctcgaagaagatagtacactg
ccagtagaggatgaagatgatgatgaggatgaggattgtgctgccaatggctttcacaaa
ttgtccttggatgaagaacctgaagatgatacagacagcttcagtgaacttcataattca
aaattgtaccaagtagtgaatgaggacccggaaaccgcattttgcactcttgcaaacagg
gaagaaataaatacagaagaaagttcagtccttcattgtttatatcagttcactcataat
gagaaactttgtgagaacaataagctgctctgtgacgtttgcacacacaaacaactttgt
ggaccaaagactactggaaaaaatgtcaagaaacctgtatacactaatgccaaaaaacaa
atgttaatttctcttgctcctccaattttaactcttcatttaaaaagatttcaacagact
ggatataatctccaaaaagtgaacaaacatataaaatttcccgaagtcatagatttggct
cctttctgctcaattaagtgcaagaatgttgcagaagggagttcaagagtcctgtattct
ttatatggaattgttgaacacagtggtacaatgagatctggccactacactgcatatgtg
aagacgagagctactaccaaccaactttctgatcttgtcctccatggcaggattcagcat
acagatgcagagactgaatcatccaaaggacaatggtttcatatcagtgacacccgagtg
caagcagttcctgtatccaaagtactgaatgcacaagcatatctcctgttctatgaacga
ctactataa

DBGET integrated database retrieval system