KEGG   Anolis carolinensis (green anole): 100556988Help
Entry
100556988         CDS       T01608                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 1B-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100556988
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100556988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 633 aa AA seqDB search
MSSQHSHAPFSSIQPMAEHQQIMPDLAILQRRIPLTFRDSATAPLRKLSVDLIKTYKHIN
EVYYAKKKRRALQVAPEDTSTKKERKVHNEGYDDDNYDYIVRNGERWLERYEIDSLIGKG
SFGQVVKAYDQQAQEWVAIKIIKNKKAFLSQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRSHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLG
CILVEMHTGEPLFSGANEADQMSRIVEVLGLPPPHMLEQAPKARKYFEKLPEGGWVLRRG
KDGRKDYKVPGTRRLHEVLGVENGGPGGRRVGEQGHSPSDYLKFKDLVLRMLDYEPRSRI
TPFYALQHNFFKKTADEGTNTSASTSPSLGTEHSHSTSTTSSVSSSGGSSGSSNDNRGYR
YSNRYYGSMGTVHADCEMQSPQAPPQQQMRLWASGDNESIPHILPHKPTPSQAMPCFPPS
GHPPYQRPPLPLSPPLPEAMEVSLGPRHLDCNPTGLGSSTLHLGASAFRTRTAGGSRPEG
LGLNYPLRGRGHRDTDETALMGVCVPQGTAASS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccagcacagccatgctcccttctccagcatccagcctatggctgagcatcag
cagatcatgccagacctggccattctgcagaggagaatcccactcactttccgggactcc
gccacagccccattacgcaagctgtctgtggaccttatcaaaacatacaaacatatcaat
gaggtctattatgccaagaagaagcgtcgagcccttcaagtggcaccagaagacaccagc
accaagaaggagcgcaaagtacacaacgagggatacgatgatgacaactatgattacata
gtccgcaatggggagcgctggctggaacgttatgaaatagactcacttattggcaagggg
tcctttggacaggtggtaaaggcctacgaccaacaggcgcaggagtgggtggctattaag
ataatcaagaacaagaaggcatttttgagtcaggctcagattgaattgcggttgcttgag
ctcatgaaccagcatgacactgaaatgaaatactatattgtgcacttgaagcggcatttc
atgttccggagccatttgtgcctggtatttgagttgctgtcctacaacctgtatgacctg
ctccgtaacaccaacttccgaggtgtctctctcaacctcacacgcaagttcgcccagcag
ctgtgcacagcactgctcttcctggcaacacctgagctcagtatcatccactgtgacctt
aagccagagaacatcttgctgtgtaaccctaaacgcagtgccatcaagattgtggacttt
gggagctcctgccagctgggccagcggatctaccagtacatccagagccgattttaccgc
tcacctgaagtgctactgggcatgccttatgatctggcaattgacatgtggtccctaggc
tgcatcctagtagagatgcacacaggggagcccctcttcagtggtgccaatgaggcggac
cagatgagccggattgtggaggtccttgggctcccgccacctcacatgttggagcaggct
cccaaggctcggaaatacttcgagaagctgcctgaggggggctgggtcctccggcggggc
aaagatggcaggaaggactacaaggttccaggcacgcggagactgcatgaagtgttaggg
gttgaaaatgggggcccaggcgggcgccgtgtaggagaacagggccattcaccttctgac
tacctgaagttcaaggacttggtattgcgcatgttggactatgaaccccgtagccgcatc
accccattctatgccctgcagcacaacttcttcaagaaaactgctgatgagggcaccaac
acgagtgccagcacctctcctagcctgggaactgagcacagccactctaccagcaccacc
agttctgtatccagttctggtggttccagtggttcttccaatgacaaccgtggttaccgt
tacagcaatcgttactatggcagcatgggcactgtgcatgcggactgtgagatgcagagc
ccccaagcaccccctcagcagcagatgcgtctttgggccagcggcgacaacgagagtatt
cctcacatcttacctcacaagcccacgccaagccaggccatgccatgtttccccccaagt
gggcaccctccgtaccagcgccctccgcttccactatctccccctctcccagaggccatg
gaggtgtctctgggccctcgccatctagactgcaaccccacggggctgggctcttccacc
ttgcacttgggcgcctcagccttccggactaggactgctggtggctcgcgccctgaggga
ctcggcctcaattaccctctccgtgggcgcgggcaccgagacactgatgagactgcactg
atgggtgtctgtgtgccccagggcaccgctgccagctcctga

DBGET integrated database retrieval system