KEGG   Anolis carolinensis (green anole): 100557123Help
Entry
100557123         CDS       T01608                                 

Gene name
bap1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100557123 (bap1)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100557123 (bap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 728 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDETSVIDEDIVNNMFFAHQLIPNSCATHALLSVLLNCNSVDLGPTLSRMKEFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRL
FELDGLKVYPIDHGPWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRVK
YESKLQILKMNRQTVLEALQQLIRVTQPELVHTQKAQESQASEEPKPVNSKTSSTALETG
RVQLIAENSQAGTTEEPGSQKPPASTLSPPSKAKTDSKMPVSSINGALSNLNPIVQRLPA
FLDNHNYAKSPMQEEEDLAAGVGRNRVPVRQHQQYSDDEDDYDDEEEEEVCNASPAMRKG
QGKHEHLVGSGDGKLSMLQPNTISVLTEKLKETQKDLSIPLSIKTSSGGSAVAMVVHSQP
SPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGDEDSLLRVDCI
RYNRAVKDLGPIISTGLLHLTEDGVFGSLTVTDGGKSSSPSSKVNEEVQSIVKLEERDLN
ERNDSNDSKEKTGIARSTNAPVGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFK
IDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRS
RPYKAKRQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggaactggagagcgaccccgggctcttcacactcttagttgag
gattttggtgttaaaggggtgcaagttgaagaaatctatgatttacagagcaaatgccaa
gggccagtctatgggttcatcttcctttttaaatggattgaagaacgtcgttctcggcgg
aaggtctcaactcttgtagatgagacatcagtgattgatgaggacattgtcaataatatg
ttctttgctcaccagctgattcccaattcttgtgccacacatgcgttgttgagtgtcctc
ttgaactgcaatagtgtggatttggggcctactctgagccgaatgaaggaattcaccaaa
ggatttagtccagagagtaaaggttatgccattggaaatgccccagaactggctaaggcc
cataacagccatgcgcggccagagccccgacatttaccagaaaaacagaatgggattagt
gcagtgcggacaatggaggcttttcactttgtcagttacgttcctattaagggacggctt
tttgaactggatgggctgaaggtttatcccattgaccatgggccctgggcggaagatgag
gaatggacagataaagccaggagagttatcatggagaggattggattggctacagcaggg
gaaccatatcatgacattcgatttaacttaatggcagtagttcctgacaggagggtaaaa
tatgaatccaagctgcagatcttgaagatgaaccggcaaactgtattagaggccttgcaa
cagttaatcagagtaactcagccagagctggtccacacccaaaaggctcaagagtctcag
gcttctgaggagcccaaaccagtcaacagcaagacttcttccactgcactggaaacgggg
agagtgcaactgattgcagagaactcacaggcaggaacgacagaggaacctggcagccag
aagccacctgcctcaaccctgagtcctcccagcaaggcaaagacggacagtaagatgcct
gtgagcagtatcaacggggcactttcaaacctgaatcctattgtacagagacttccagct
tttttggataatcataactatgccaagtctcccatgcaggaggaagaggatcttgcagca
ggagtgggccgaaaccgagtcccagtacggcaacaccagcagtactccgacgatgaggat
gactacgatgatgaagaggaggaggaagtgtgcaatgccagtcctgccatgaggaagggc
caggggaagcatgagcacctggttgggagtggagatggcaagctctccatgctccagccc
aacaccatcagcgtcctcaccgagaagttgaaggagacccagaaggacctctccatccct
ctatctatcaagaccagcagtggaggcagtgcagttgccatggtggtccattcccagccg
tctcccacccccagcaatgagagcacagacactgcttctgagatcgggagtgccttcaat
tccccgctccgctcccccatccggtcagccaatcccactcgcccctccagccctgttacc
tctcacatctccaaggtgctatttggggacgaggacagcctgctgcgggtggactgtata
cgctacaaccgggcagtgaaagatttggggcctatcatcagcacaggcttgctgcacctc
accgaggatggggtttttgggtcacttacagtaacagatggtggaaaaagctcttctccc
tctagcaaagtgaatgaagaggtccagtcaattgttaaactagaagagagagacctgaat
gagcgaaatgacagcaatgacagcaaggagaagactggaattgctcggtctactaatgct
cctgttggggaaaagtattctcccaaagagctgctggcactacttaagtgtgtggaggct
gagattgccaattatgaagcctgtctaaaggaggaagtagagaaacgaaagaagttcaag
attgatgaccagagaagaactcacaattatgatgagtttatatgtacctttatctccatg
ctggcacaagaaggaatgcttgctagcctggtagagcagaacatctctgtgcgcagacgg
caaggggtcagcattgggcgcctccacaagcagcggaagcctgaccggcggaaacgttcc
cggccttataaagccaaacgtcagtag

DBGET integrated database retrieval system