KEGG   Anolis carolinensis (green anole): 100557123Help
Entry
100557123         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase BAP1-like
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 729 aa AA seqDB search
MAFSEGRQVNGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKV
STLVDETSVIDEDIVNNMFFAHQLIPNSCATHALLSVLLNCNSVDLGPTLSRMKEFTKGF
SPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFE
LDGLKVYPIDHGPWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRVKYE
SKLQILKMNRQTVLEALQQLIRVTQPELVHTQKAQESQASEEPKPVNSKTSSTALETGRV
QLIAENSQAGTTEEPGSQKPPASTLSPPSKAKTDSKMPVSSINGALSNLNPIVQRLPAFL
DNHNYAKSPMQEEEDLAAGVGRNRVPVRQHQQYSDDEDDYDDEEEEEVCNASPAMRYQRK
GQGKHEHLVGSGDGKLSMLQPNTISVLTEKLKETQKDLSIPLSIKTSSGGSAVAMVVHSQ
PSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGDEDSLLRVDC
IRYNRAVKDLGPIISTGLLHLTEDGVFGSLTVTDGGKSSSPSSKVNEEVQSIVKLEERDL
NERNDSNDSKEKTGIARSTNAPVGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcgttttcagagggacgtcaagtgaacgggctcttcacactcttagttgaggatttt
ggtgttaaaggggtgcaagttgaagaaatctatgatttacagagcaaatgccaagggcca
gtctatgggttcatcttcctttttaaatggattgaagaacgtcgttctcggcggaaggtc
tcaactcttgtagatgagacatcagtgattgatgaggacattgtcaataatatgttcttt
gctcaccagctgattcccaattcttgtgccacacatgcgttgttgagtgtcctcttgaac
tgcaatagtgtggatttggggcctactctgagccgaatgaaggaattcaccaaaggattt
agtccagagagtaaaggttatgccattggaaatgccccagaactggctaaggcccataac
agccatgcgcggccagagccccgacatttaccagaaaaacagaatgggattagtgcagtg
cggacaatggaggcttttcactttgtcagttacgttcctattaagggacggctttttgaa
ctggatgggctgaaggtttatcccattgaccatgggccctgggcggaagatgaggaatgg
acagataaagccaggagagttatcatggagaggattggattggctacagcaggggaacca
tatcatgacattcgatttaacttaatggcagtagttcctgacaggagggtaaaatatgaa
tccaagctgcagatcttgaagatgaaccggcaaactgtattagaggccttgcaacagtta
atcagagtaactcagccagagctggtccacacccaaaaggctcaagagtctcaggcttct
gaggagcccaaaccagtcaacagcaagacttcttccactgcactggaaacggggagagtg
caactgattgcagagaactcacaggcaggaacgacagaggaacctggcagccagaagcca
cctgcctcaaccctgagtcctcccagcaaggcaaagacggacagtaagatgcctgtgagc
agtatcaacggggcactttcaaacctgaatcctattgtacagagacttccagcttttttg
gataatcataactatgccaagtctcccatgcaggaggaagaggatcttgcagcaggagtg
ggccgaaaccgagtcccagtacggcaacaccagcagtactccgacgatgaggatgactac
gatgatgaagaggaggaggaagtgtgcaatgccagtcctgccatgaggtaccaaaggaag
ggccaggggaagcatgagcacctggttgggagtggagatggcaagctctccatgctccag
cccaacaccatcagcgtcctcaccgagaagttgaaggagacccagaaggacctctccatc
cctctatctatcaagaccagcagtggaggcagtgcagttgccatggtggtccattcccag
ccgtctcccacccccagcaatgagagcacagacactgcttctgagatcgggagtgccttc
aattccccgctccgctcccccatccggtcagccaatcccactcgcccctccagccctgtt
acctctcacatctccaaggtgctatttggggacgaggacagcctgctgcgggtggactgt
atacgctacaaccgggcagtgaaagatttggggcctatcatcagcacaggcttgctgcac
ctcaccgaggatggggtttttgggtcacttacagtaacagatggtggaaaaagctcttct
ccctctagcaaagtgaatgaagaggtccagtcaattgttaaactagaagagagagacctg
aatgagcgaaatgacagcaatgacagcaaggagaagactggaattgctcggtctactaat
gctcctgttggggaaaagtattctcccaaagagctgctggcactacttaagtgtgtggag
gctgagattgccaattatgaagcctgtctaaaggaggaagtagagaaacgaaagaagttc
aagattgatgaccagagaagaactcacaattatgatgagtttatatgtacctttatctcc
atgctggcacaagaaggaatgcttgctagcctggtagagcagaacatctctgtgcgcaga
cggcaaggggtcagcattgggcgcctccacaagcagcggaagcctgaccggcggaaacgt
tcccggccttataaagccaaacgtcagtag

DBGET integrated database retrieval system