KEGG   Anolis carolinensis (green anole): 100557141Help
Entry
100557141         CDS       T01608                                 

Definition
d-beta-hydroxybutyrate dehydrogenase, mitochondrial-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100557141
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    100557141
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     100557141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 290 aa AA seqDB search
IGERGVLITGCDSGFGFALAKHLHERGFIIYAGCLLKEQGRGGSKELDDMKSDRMRTVQL
NVCDSEEVGRAVDHVTATMKDEAGLWGLVNNAGISTFGEVEFTSMDTYKEVAEVNLWGTI
RTTKSFLPLIRRAKGRVVNISSMMGRMANPARSPYCITKFGVEAFSDCLRYEMRPHDVKV
CIVEPGNFIAGTSLYSPERIQAIADKMWDELPEIVRRDYGRKYFDEQIAKMESYCNSGSA
DTSPVIDSITHALTSTTPYTRYHPMDYYWWLRMQVMTHMPAAISDRLYIY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atcggggagcgtggtgtcctgatcaccggctgcgactccggctttggctttgcgctggcc
aagcatctccacgagaggggcttcatcatctacgccgggtgcctcctcaaggaacaaggc
cgggggggctccaaggaactggacgacatgaagagtgaccgcatgcggaccgtccagctc
aacgtctgcgacagtgaagaagtggggcgtgccgtggaccacgtgactgcgaccatgaag
gacgaggctgggctctggggcctggtgaacaacgcggggatctccaccttcggggaagtc
gagttcaccagcatggacacctacaaggaggtggccgaagtgaacctgtggggcaccatc
cgcaccaccaagtccttcctgcccctcatccgcagagccaaaggccgcgtggtgaacatc
agcagcatgatggggcgcatggccaacccggcgcgctcgccctactgcatcaccaagttc
ggggtggaggccttctccgactgcctgcgctacgagatgcgccctcatgacgtcaaggtg
tgcatcgtggagccgggcaacttcatcgcgggcaccagcctctacagccccgaacgcatc
caggccatcgccgacaagatgtgggacgagctgccggagatcgtgcggcgcgactatggg
cggaagtactttgacgagcagatcgccaagatggagtcgtactgcaacagcggctcggcc
gacacctccccggtcatcgacagcatcacccacgccctgacctccaccaccccctacacc
cgctaccaccccatggactactactggtggctgcgcatgcaggtcatgacccacatgccc
gccgccatctccgaccgcctctacatctactga

DBGET integrated database retrieval system