KEGG   Anolis carolinensis (green anole): 100557416Help
Entry
100557416         CDS       T01608                                 

Definition
filamin-B-like
Orthology
K04437  
filamin
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100557416
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100557416
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100557416
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100557416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 2693 aa AA seqDB search
MSASAQARVQVQAARGERRAHSPDSQSPALPRLEKQQQQQKQDVVASVAVPRASEPDIMP
VTEKDLAEDAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQCDLSDGLRLIALLEVLSQKRM
YRKYHQRPTFRQMQLENVSVALEFLERENIKLVSIDSKAIVDGNLKLILGLVWTLILHYS
ISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGL
CPDWETWDPKKPVDNAREAMQQADDWLGVPQVITPEEIIHPNVDEHSVMTYLSQFPKAKL
KPGAPLKPKLNPKKARAYGRGIEPHGNMVKQPAKFTVDTISAGQGEVMVFIEDPEGNREE
AMVSPENDKNKTYAVQYVPKVTGPHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAKGP
GLEATGNIANKPTYFDIYTAGAGVGDIDIDVEDPQGKNIAEVFLEDKGNQVHRCVYKPLQ
AGPHTIRVTFAGEEVPKSPWGVVVGEACNPNACRASGRGLQPKGVRIRETADFKVDTKAA
GSGDIHVAVRGPKGLEELVKQKEFMDGVYSFEYYPVIPGKYMATILWGGHNIPKSPFEVQ
IGPEAGPQKVRAWGPGLHEGVVGKSADFVVESIGPEVGSLGFAIEGPSQAKIECDDQNDG
SCDVKYWPKEPGEYAIHVMCDDEDIKDSPYMASIQPASPNFDSNKVKAYGPGLERTGCIV
NNPAEFTVDTKEGGSAPLKIYAQDGDGNPIDIQMKSKPDGIFACSYVPTKPIKHTIAVTW
GGANVPNSPYRIQIGQGSHPYKVKVIGPGMERTGLKANEPTHFTVDCTEAGEGDVNVGIK
CDANVINEEEQDIDFGIIPNANDTFTVKYTPPAAGRYTVKVLFAGEEIPTSPFRVKVEPS
HDASKVKAEGPGLSKTGVENGKPTHFNVFTKGAGKAPLDVQFNGPMAGDAVKDLDIIDNY
DYSHTVRYTPIQQGNMDILVNYGGDPIPRSPFTVGVAAPLDLSKIKLNGLENRVEVGRDQ
EFLIDTKGAGGQGKLDVSILSPARKAVPCLVEPVVGKECCTAKYIPKEEGLHVVDVNYDG
NPVPGSPYTVEATLPPDPTKVRAYGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCE
AKIECSDNGDGTCSVSYLPTKPGEYLVNILFEEVHIPGSPFRADVEMPFDVSKVIATGPG
LEHGKVGEAGLLNVDCSEAGPGKLDMEAVSDSGSKADVEVQDNNDGTYAVTYVPVSAGMH
TLKMKYGGEPVPNFPSRVKVDPAVDTSKIQVYGPGIEGKDVFREATTDFTVDASPLTKTG
GNHIKAQISNPSGASTDCLIKDNADGTYAVEFTPYEKGPHTVDVTYDDVPVLNSPFRVDV
TEGCHPSRVEAQGPGLQEALTNKPNPFTVVTRGAGIGGLGITVEGPSESKISCKDNKDGS
CSAEYIPYVPGDYDVNITYGGEHIPGSPFKVPVKDVIDPYKVKVLGPGLGTAVRAKIPQA
FTVDTSKAGIAPLEVAVTGPRADEPDSQSWRSPLKAISEFFKGDPQVESNETGLAEPVNI
VDNGDGTHTVAYTPTQEGPYTIAVKYADEEIPRSPFKVKVLPTYEASKVTASGPGLNAHG
VPASMPADFIVDAKDAGQGLLSVNVTDQDGKPKKADIHDNNDGTYAVTYIPDKTGRYSVG
IKYGGDDIPFSPYRVRVSPAGDASKCLATGPGIAATVKTGEEVGFVVDAKSAGKGKVTCT
VLTPDGTEAEAEVIENEDGTYDIYYTAVNPGTYVIYVRFGGVDIPNSPFTVVATDPDEVA
VLSQEPLNAACPPGFQPWVTEEAYVPDGAMNGIGFKPFDMVIPFAVRKGEITGEVHMPSG
KTATADIMDNKDGTVTVRYAPVEVGLHEMHIKYMGNHIPESPLQFYVNYPNSGNVTAYGP
GLVYGVANKPATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGNYS
ILVKYNEKHIAGSPFVAKITDDNRRRSQVKLGSAADFLLDINETDLSLLTANIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSILKNGSHVPNSPVSIMVVQSEIGDANRARVYG
RGLVEGRTFEMCDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLDDGTCRVSYFPTVPGVY
IVSTKFADEHIPGSPFTVKVSGEGRVKESITRARRAPSVATVGSLCDLNLKIPEIDIGDM
SARVTSPSGRTTDAEIVEHDKNTYCVRFVPQEMGVHTVDVKYRGQHVPGSPFQFTVGPLG
EGGAHKVRAGGPGLERAEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDHKDGSCG
VSYTAQEPGNYEVSVKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPAAFA
IRLNGAKGKIDAKVHSPNGAVEECHVSELEQDKYAVRFIPRENGIHSIDVKFNGSHVVGS
PFKVRVGEPGQVESPALVTAYGPGLESGTTGLQSMFTIDTTKAGPGTLAVTIEGPSKVKM
DCQEAPEGYNVMYTPMAPGNYLIGIKYGGPNHIAGSPFKAKVTGQRLVSPGVSNEMSSIM
VESVTRSTTDTCYSAIPKSSSDASKVTSRGAGLSRAFVGQKNSFSVDGSKAGSNMLLVGV
HGPTTPCEEVSVKHLGNHQYNVTYVVKEKGDYILAVKWGEEHIPGSPFHVTVP
NT seq 8082 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgagtgcgcaggcgcgggtccaggtccaggcggctcgcggcgagaggcgcgcg
cacagccctgactcgcagtcgcctgctcttcctcggctggagaagcagcagcagcagcaa
aagcaggacgttgtcgcctctgtcgctgtcccccgcgcctcggagcccgacatcatgccg
gtgacggagaaggacctggcggaggacgcgccctggaagcggatccagcagaacaccttc
acccgctggtgcaacgagcacctccgctgcgtgaacaagcgcatcgggaacctgcagtgc
gacctgagcgacgggctgcggctgattgcgctgctggaggtgctcagccagaagcgcatg
taccgcaagtaccaccagcgccccaccttccgccagatgcagctggagaacgtctccgtg
gccctcgagttcctcgagagggagaacatcaagctcgtctccatcgacagtaaagctatt
gttgatgggaacttgaagctaatcctagggttggtatggacccttatcctccattattca
atctctatgcccgtttgggaagatgaaggagatgatgatgccaagaaacagactccaaaa
cagagactcttgggatggattcagaacaaaatcccatatttgccaattacaaactttaac
caaaactggcaagatggcaaagcactgggtgcccttgtggatagctgtgctcctggtctt
tgcccagattgggaaacctgggaccctaagaagcccgttgataatgcccgtgaagccatg
cagcaagcagatgactggctgggtgtacctcaggtcatcactccagaagaaatcatacat
cctaatgtggatgagcattctgtaatgacgtacttgtcacagttccccaaagccaagctg
aaaccaggtgctcctctgaaacctaaacttaatccaaagaaggcaagagcatatggcaga
ggaattgaaccacatggaaatatggtgaagcagcctgccaaatttactgtagacactatc
agtgctggccagggtgaagtcatggtttttatagaagacccagaaggcaacagagaagag
gccatggtgtctccagaaaatgacaagaacaagacctatgctgttcaatatgtgccaaag
gttacaggaccacacaaggttacagtcctgtttgctggtcagcatatttcaaagagccca
tttgaagtcaatgttgacaaggcacagggagatgccagcaaagtaacagccaaagggcca
ggcttggaagcaacaggaaatatagccaataaacctacttattttgacatttatacagca
ggggcaggtgttggtgatatagacatagatgttgaagaccctcaagggaagaacattgct
gaagtttttctagaagacaaagggaatcaggtccaccgctgtgtgtacaagcctcttcaa
gctggtcctcacactattagagtgacgtttgctggagaagaagttccaaaaagcccttgg
ggagttgttgttggtgaagcctgcaatccaaatgcctgccgtgccagcggcagaggcctc
cagcctaaaggagttcggatcagagaaaccgcagacttcaaggttgatactaaagccgca
gggagtggagatatccatgttgcagtaagagggccaaagggcttagaggaacttgtgaaa
caaaaggaattcatggatggtgtatattcatttgaatattacccagtaattccaggaaaa
tacatggcaacaatcttgtggggaggccataacatccccaaaagcccttttgaagttcaa
ataggtcctgaagcaggcccgcaaaaagtaagagcttgggggccaggtcttcacgaagga
gttgttggtaaatctgctgactttgtggtagaatccattggtccagaagttggatcgctt
ggctttgccattgaaggcccgtctcaggcaaaaattgaatgtgatgatcagaatgatggc
tcatgtgatgtgaaatactggcctaaggagcctggtgaatatgccatccacgtcatgtgt
gatgatgaagacatcaaagacagtccctacatggcttccatccagccagcttctccaaac
ttcgactccaacaaggtaaaagcttatggtccagggttggagagaactggctgtattgtg
aacaatcctgcagagtttacagttgacacaaaggaaggtggcagtgctcctctgaagata
tatgcacaggatggggatggaaatcctattgatatccaaatgaagagcaaaccagatggc
atctttgcttgctcgtatgttcccacaaagccaatcaagcacacaattgctgttacttgg
ggaggagcaaatgtgcccaatagtccttacaggatccagattggacaaggtagccatccc
tacaaggtgaaagttattggaccaggaatggagagaactggactgaaagctaatgaacca
actcactttacagtagactgcacagaagcaggagaaggtgatgtgaatgttggcatcaaa
tgtgatgctaatgtcatcaatgaagaagaacaagacatagactttggcatcatacctaat
gctaatgatacattcacagtgaaatatacacctcctgcagctggacgctacactgtcaaa
gtgctttttgctggagaggaaatccctactagccctttcagagtgaaagtggaaccttca
catgacgcaagcaaagtgaaagctgaaggacctggtctcagcaaaacaggtgtggaaaat
gggaagcctacacacttcaatgtcttcacaaaaggtgctgggaaggcccctctcgatgtc
cagttcaacggaccaatggcaggagatgctgtcaaagatcttgacatcattgacaactat
gattattctcacactgtgagatatactccaatacagcagggtaatatggatattctggtg
aattatggtggtgatcccatcccaagaagtcctttcactgttggtgttgctgctccactt
gacctgagcaaaattaagcttaatggtctggaaaatcgagttgaagtaggaagggaccaa
gaatttctgattgacacaaaaggagctggtggacagggcaaactggatgtctcgatctta
agccctgccaggaaagctgtgccatgcttagtggaaccagtagtaggcaaagagtgttgc
actgcaaagtatatcccaaaggaagagggccttcatgtggttgatgtaaattatgatggg
aatccagttccaggaagcccttatacagtggaggccaccctgccaccggatcccaccaaa
gtgagagcctatggtcctggtcttgagggcggccttgtcggaaagcctgcagaattcaca
atagacaccaaaggagctggaaccgggggcctgggactgacagtcgaaggaccgtgtgaa
gctaaaatagagtgttctgataatggtgatggaacatgctcagtctcttacttgccaaca
aaaccaggtgaataccttgtcaacattctttttgaagaggtccatattcctggttctcca
ttcagagcagatgttgaaatgccatttgatgtttccaaagtaattgccactggccctgga
cttgaacatggtaaagtcggtgaggctgggttgctaaatgtggactgttccgaagctggg
cctgggaaactggatatggaagctgtgtctgactctggttctaaagcagatgttgaggtt
caggataataatgatggtacctatgcagttacatacgtacctgtttctgctgggatgcat
acactcaaaatgaagtatggtggagaaccggtaccaaactttccgtcacgagtcaaggtt
gatccagctgtggacacaagcaaaatccaagtgtatgggccagggatcgaaggaaaagat
gtcttccgagaagcaacaacagatttcactgtagatgctagtcctttgaccaaaactggt
ggaaaccatatcaaagcacaaatttcaaatccctctggagcttccacagactgccttata
aaagacaatgcagatgggacatatgccgtagagttcactccatatgaaaaaggccctcat
actgttgacgtaacgtatgatgatgtccccgtgttaaacagtcctttcagagttgatgtc
acagagggatgtcatccttcacgcgtcgaagcccaaggacctgggctacaggaagccctc
acaaataaacccaacccattcactgttgtcactcgaggggctggaattggtggccttgga
ataactgttgaaggaccttcagaatctaagataagctgcaaagataacaaggatggcagc
tgtagtgcagaatatatcccatatgttccaggggactatgatgtcaatataacctatgga
ggtgaacatatccctggaagtccattcaaggttcctgtaaaagatgtcattgacccctac
aaagtgaaagttttgggaccaggcctgggaacagcagttcgtgccaaaattccccaggcc
tttactgtggacaccagtaaggctggaattgcaccacttgaggttgctgtcacgggtccc
agagctgatgagccggattcccagtcatggcgcagtccactgaaagcaatttcagagttc
tttaaaggtgacccacaggttgaatctaatgagacaggcctggcagagcctgtgaacata
gttgacaatggtgatggcactcatacagtagcatacacacctacgcaggagggtccttat
acaattgcagtaaaatatgcagatgaagagattcctagaagcccattcaaagtgaaggtg
cttcctacgtatgaagccagtaaagtgactgctagtgggcctggcctcaatgcccatggg
gtcccagccagcatgcctgctgatttcattgttgatgctaaagatgctggtcaaggactt
ctctcagtaaatgtgactgaccaagatggcaaaccaaagaaggcagatatccatgacaac
aatgatggaacttatgcagtaacttacattcctgacaagacgggtcgatattctgttggc
attaaatatggtggggatgatatacctttttctccttaccgagttcgtgtatcaccagct
ggagatgccagcaaatgtctagcaacaggtcctggcattgcagccacagtgaagacagga
gaagaagttggctttgtagtagatgctaaatctgcgggcaagggcaaagtgacatgcact
gtactgacaccagatggcacagaagccgaagcagaggtcattgaaaacgaagatggaaca
tacgatatttattatacagctgttaatccaggaacctatgtaatttatgtccgctttggt
ggagtggatattccaaacagccctttcactgttgtggctacagatccagatgaagttgca
gtattgtctcaggaaccactaaatgcagcctgtccccctggattccagccctgggtcaca
gaagaagcgtatgtacctgatggtgccatgaatggtataggatttaaaccctttgatatg
gtcattccttttgcagtaagaaaaggagaaataactggggaagtccacatgccctcaggg
aagaccgcaacagcagacattatggataacaaggatggcacggtcacagtcagatatgct
cctgttgaggttggattgcatgaaatgcacatcaaatacatgggcaaccatattccagag
agtcctctacaattctatgtcaactatccaaatagtggaaatgtgactgcatatggacct
ggccttgtctatggtgtagcaaacaagccagcaacttttaccatagtcacagaagatgct
ggtgaaggtggcttggatttggcaattgagggtccttcaaaagctgagatcagttgtatt
gataataaggatggtacttgcacagtcacttacttgccaactcttccaggaaactatagc
atcttagtcaagtacaatgagaaacatattgcaggaagcccatttgttgccaaaatcaca
gatgacaataggaggcgttcccaagttaagcttggctctgctgctgatttcttgctggac
attaatgagactgatctgagcctcttgaccgcaaatattaaagcgccatctggcagagat
gaaccttgtcttctgaaaagactaccgaataaccacattggtatctcattcattccacgg
gaagtgggagagcacctggtcagtattttgaagaatggaagtcatgtaccaaacagtcca
gtgtctatcatggtggttcagtctgagattggtgatgcgaacagagcgagagtttatgga
cgaggtttggtggaagggcgtacatttgaaatgtgtgacttcattgtagatacaagagat
gcaggttatggtgggatatcactagcagtggaaggacctagcaaagtggatatccagaca
gaagatctagatgatgggacttgcagggtgtcatacttcccaacggttcctggtgtttac
atagtgtcaactaaatttgctgatgaacacatcccagggagtccattcacagttaaagta
agtggtgaaggaagagtgaaggaaagcatcacgcgtgcacgaagggctccttctgtggcc
accgttggaagcttgtgtgatcttaacttaaagattccagaaattgatattggtgacatg
tcagctagggtcactagcccatcggggagaactacagatgcagaaatcgtagagcatgat
aaaaacacatactgtgtccgctttgtgccgcaagaaatgggagtccataccgttgatgtg
aaatacagagggcagcatgtgccaggcagtccgttccaattcactgttgggccacttggt
gaaggaggagctcataaagtcagagctggtggtccaggacttgaaagagcagaggcaggc
attccagctgaattcagcatatggacaagagaagctggagctggagggctttctattgct
gtagaaggtccaagtaaggcagaaatcacttttgaagatcataaggatggatcttgtggt
gtatcatatactgctcaagaacctggtaactacgaggtgtctgtcaaattcaatgatgag
catattcctgagagcccctacttggttcctgtgatagctccttcagatgatgcgcgtagg
ctcactgttatgagccttcaggagtctgggttgaaagttaaccagccagcagccttcgca
attagacttaatggagcaaagggcaagattgatgctaaagtgcacagcccaaatggagct
gtagaagagtgtcatgtttctgaactggagcaagataaatatgctgtacggttcatccca
cgtgaaaatggtattcattctattgatgtgaagttcaatgggagccatgttgtaggcagt
cctttcaaagtcagagttggggaaccaggtcaagtcgaaagcccagctcttgttactgcc
tatggcccaggccttgagagcggcacaacaggattgcagtctatgtttactatagacacc
accaaagctggcccaggtacccttgctgttaccattgagggcccgtcaaaggtgaaaatg
gattgccaggaagctccagagggctacaatgtcatgtacactcctatggctccaggaaac
tacttaattggaattaaatatggaggccctaatcacatagctggcagccctttcaaagca
aaagtgacaggtcagcgattggttagcccaggggtctcaaatgaaatgtcttctatcatg
gtggaatctgtcacaaggtcaacaactgatacttgttatagtgccattcccaaatcttca
tctgatgcaagcaaagtcacctccagaggggcagggctctctagagcttttgtgggccag
aaaaattctttctctgttgacggcagcaaagcaggttcaaatatgttgttggttggagtc
catggaccaacaacaccttgtgaagaagtatctgtgaaacacttgggaaaccatcagtac
aatgtaacatatgttgtgaaggagaagggtgactacattctggctgtaaagtggggtgaa
gaacacattcctggaagcccatttcatgttactgttccctaa

DBGET integrated database retrieval system