KEGG   Anolis carolinensis (green anole): 100557473Help
Entry
100557473         CDS       T01608                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:acs00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:acs00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 341 aa AA seqDB search
MTEVKRESFGECRDGRGTVEKFLLKSDAVKVEIISLGCIITALETKDRDGKFADIVLGFD
HLEGYIQKNPYFGAVVGRVANRIAKGKFVVEGREYHLALNNGPNSLHGGIKGFDKAVWTP
EVLPEGVRFFRISPDGEEGYPGELKVWVTYTLKNAELTIHYRAQSSKTTPVNLTNHSYFN
LAGQGSQSIYDHEFTIDADSYLPVDETQIPTGEVASVEGTAFDLRKPVELGRHLQKFHLS
GFDHNFCLKQTKKPRFCARAYHPSSGRMIEVYTTQPGIQFYTGNSLDGTLKGKGGHVYPK
HSGFCLETQNWPDAVNQVHFPNVLLHPGEEYSTTTSFKFSA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagtaaagagagagagtttcggggaatgtcgtgatggcagagggaccgtggaa
aaattcctgctcaagtcagacgcggttaaagtggaaatcatctctttaggctgcataatc
actgccttggaaaccaaagacagggatggcaaattcgcagacattgttctgggctttgat
cacctggaagggtacatccaaaagaacccctattttggagccgttgttggacgggttgct
aacagaattgccaaaggaaagtttgtggttgaaggacgggagtatcacttggctctcaac
aatggacccaacagtctgcatgggggtataaaaggctttgacaaggctgtctggactcca
gaagtacttccagaaggtgtaaggtttttcagaataagtcccgatggtgaagagggatac
cccggtgaactgaaagtgtgggtgacgtataccctgaagaatgctgaactaacaatacat
tatagagctcaaagcagtaagaccacaccagtcaatctgaccaaccattcatacttcaat
cttgcaggtcaggggtcacagagtatctatgaccatgaatttaccatagatgcagattct
tacctgccagtagatgaaactcagatccccacaggagaagttgcttctgtggagggcaca
gcctttgatctgagaaaaccagtggagcttgggagacatttgcagaagtttcacctcagt
gggtttgaccacaatttttgtctgaaacagacgaaaaagcctcgcttctgtgcaagagct
taccatccctctagtggcaggatgatagaagtttacacaactcagcctggcattcagttt
tacactggaaattccttagacggcaccttaaagggcaaaggaggccatgtatatcctaag
cattccggtttctgtcttgaaactcagaactggccagatgcggtgaatcaggttcatttc
ccaaatgttttgctgcacccaggagaggaatatagcaccacaacttccttcaagttttct
gcttaa

DBGET integrated database retrieval system