KEGG   Anolis carolinensis (green anole): 100557473Help
Entry
100557473         CDS       T01608                                 

Gene name
galm
Definition
galactose mutarotase (aldose 1-epimerase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100557473 (galm)
   00052 Galactose metabolism
    100557473 (galm)
Enzymes [BR:acs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100557473 (galm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 341 aa AA seqDB search
MTEVKRESFGECRDGRGTVEKFLLKSDAVKVEIISLGCIITALETKDRDGKFADIVLGFD
HLEGYIQKNPYFGAVVGRVANRIAKGKFVVEGREYHLALNNGPNSLHGGIKGFDKAVWTP
EVLPEGVRFFRISPDGEEGYPGELKVWVTYTLKNAELTIHYRAQSSKTTPVNLTNHSYFN
LAGQGSQSIYDHEFTIDADSYLPVDETQIPTGEVASVEGTAFDLRKPVELGRHLQKFHLS
GFDHNFCLKQTKKPRFCARAYHPSSGRMIEVYTTQPGIQFYTGNSLDGTLKGKGGHVYPK
HSGFCLETQNWPDAVNQVHFPNVLLHPGEEYSTTTSFKFSA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagtaaagagagagagtttcggggaatgtcgtgatggcagagggaccgtggaa
aaattcctgctcaagtcagacgcggttaaagtggaaatcatctctttaggctgcataatc
actgccttggaaaccaaagacagggatggcaaattcgcagacattgttctgggctttgat
cacctggaagggtacatccaaaagaacccctattttggagccgttgttggacgggttgct
aacagaattgccaaaggaaagtttgtggttgaaggacgggagtatcacttggctctcaac
aatggacccaacagtctgcatgggggtataaaaggctttgacaaggctgtctggactcca
gaagtacttccagaaggtgtaaggtttttcagaataagtcccgatggtgaagagggatac
cccggtgaactgaaagtgtgggtgacgtataccctgaagaatgctgaactaacaatacat
tatagagctcaaagcagtaagaccacaccagtcaatctgaccaaccattcatacttcaat
cttgcaggtcaggggtcacagagtatctatgaccatgaatttaccatagatgcagattct
tacctgccagtagatgaaactcagatccccacaggagaagttgcttctgtggagggcaca
gcctttgatctgagaaaaccagtggagcttgggagacatttgcagaagtttcacctcagt
gggtttgaccacaatttttgtctgaaacagacgaaaaagcctcgcttctgtgcaagagct
taccatccctctagtggcaggatgatagaagtttacacaactcagcctggcattcagttt
tacactggaaattccttagacggcaccttaaagggcaaaggaggccatgtatatcctaag
cattccggtttctgtcttgaaactcagaactggccagatgcggtgaatcaggttcatttc
ccaaatgttttgctgcacccaggagaggaatatagcaccacaacttccttcaagttttct
gcttaa

DBGET integrated database retrieval system