KEGG   Anolis carolinensis (green anole): 100557560Help
Entry
100557560         CDS       T01608                                 

Definition
renin-like
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Renin-angiotensin system
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:acs04614]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 398 aa AA seqDB search
MQLCWVFAVVTSCFLSFSSDAFQRIPLKKMPSIRETLQKMGIKVADFFPSLKHGIYFLND
GFYNGTAPTILTNYLDMQYYGEISIGTPAQIFKVVFDTGSANLWVPSQQCSPLYSACVSH
NRYDSSRSSTYKPNGTEIAIQYGQGYVKGFLSQDIVRVADIPVVQLFAEAIALPNKPFIY
ARFDGVLGMGYPSQAIDGVIPVFDKIISERVLSEEVFSVYYSRNSEMNTGGEIILGGSDP
SYYTGDFHYVSISTPGYWHIDLKGVSLGSEMLFCHEGCTAAVDTGSSFITGPASAVSILM
KSIGATLLEERDYVVECKKIHLLPDISFHLGDRSYTLSGYAYVLQYSDYGKELCAVAFSA
FDIPPPLGPIWILGATFIGQYYTEFDRQNNRIGFARSL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgtgctgggtctttgcagtagttaccagctgcttcttgtcattttccagtgat
gctttccaaagaattccactcaagaaaatgccctccatacgagaaactctccagaagatg
ggcataaaagtggcagacttcttcccttccttgaagcatggtatatactttctaaatgat
ggtttttacaatggaacagctcctaccatcctcacaaactacctggatatgcagtattat
ggcgaaatcagtattggcacaccagcgcagatcttcaaagtagtctttgacacagggtca
gccaatctttgggtgccatcccaacagtgttccccattgtacagtgcttgtgtttcacac
aaccgctatgactcttccagatcaagtacatataagccgaatggaacagagattgcaata
caatatggccaaggatatgttaaaggttttcttagccaagacattgtcagagtggctgat
attcctgttgttcagttgtttgcagaagctatagcactgcccaacaaacctttcatctat
gccagatttgatggggtacttggtatggggtatccgagtcaagctattgatggagttatc
ccagtgtttgataagataatatctgaaagagtcttatcagaagaagttttctctgtctac
tatagcagaaactctgagatgaatactgggggagagattatcctgggaggcagcgaccca
tcttactacactggggacttccactatgtcagcattagcacaccaggctattggcacatt
gatcttaaaggggtgtctctgggcagtgagatgcttttctgtcatgaaggttgcacagca
gcagtagatactggatcctcctttattactggcccagctagtgctgtgtccatattgatg
aaatccattggagctactttactcgaagaaagagattatgttgttgaatgcaagaaaatc
catttgctgcctgatatttccttccatcttggagacagatcctacacactcagtggctat
gcttatgtcctccagtattctgattatgggaaagagctttgtgctgtggcgttctcagct
ttcgacattcctcctcctctgggccccatctggattctgggtgctaccttcattgggcag
tactacacggaatttgaccggcagaacaaccggattggcttcgccagatctctttga

DBGET integrated database retrieval system