KEGG   Anolis carolinensis (green anole): 100557560Help
Entry
100557560         CDS       T01608                                 

Definition
renin-like
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:acs00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    100557560
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     100557560
Peptidases [BR:acs01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100557560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 398 aa AA seqDB search
MQLCWVFAVVTSCFLSFSSDAFQRIPLKKMPSIRETLQKMGIKVADFFPSLKHGIYFLND
GFYNGTAPTILTNYLDMQYYGEISIGTPAQIFKVVFDTGSANLWVPSQQCSPLYSACVSH
NRYDSSRSSTYKPNGTEIAIQYGQGYVKGFLSQDIVRVADIPVVQLFAEAIALPNKPFIY
ARFDGVLGMGYPSQAIDGVIPVFDKIISERVLSEEVFSVYYSRNSEMNTGGEIILGGSDP
SYYTGDFHYVSISTPGYWHIDLKGVSLGSEMLFCHEGCTAAVDTGSSFITGPASAVSILM
KSIGATLLEERDYVVECKKIHLLPDISFHLGDRSYTLSGYAYVLQYSDYGKELCAVAFSA
FDIPPPLGPIWILGATFIGQYYTEFDRQNNRIGFARSL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgtgctgggtctttgcagtagttaccagctgcttcttgtcattttccagtgat
gctttccaaagaattccactcaagaaaatgccctccatacgagaaactctccagaagatg
ggcataaaagtggcagacttcttcccttccttgaagcatggtatatactttctaaatgat
ggtttttacaatggaacagctcctaccatcctcacaaactacctggatatgcagtattat
ggcgaaatcagtattggcacaccagcgcagatcttcaaagtagtctttgacacagggtca
gccaatctttgggtgccatcccaacagtgttccccattgtacagtgcttgtgtttcacac
aaccgctatgactcttccagatcaagtacatataagccgaatggaacagagattgcaata
caatatggccaaggatatgttaaaggttttcttagccaagacattgtcagagtggctgat
attcctgttgttcagttgtttgcagaagctatagcactgcccaacaaacctttcatctat
gccagatttgatggggtacttggtatggggtatccgagtcaagctattgatggagttatc
ccagtgtttgataagataatatctgaaagagtcttatcagaagaagttttctctgtctac
tatagcagaaactctgagatgaatactgggggagagattatcctgggaggcagcgaccca
tcttactacactggggacttccactatgtcagcattagcacaccaggctattggcacatt
gatcttaaaggggtgtctctgggcagtgagatgcttttctgtcatgaaggttgcacagca
gcagtagatactggatcctcctttattactggcccagctagtgctgtgtccatattgatg
aaatccattggagctactttactcgaagaaagagattatgttgttgaatgcaagaaaatc
catttgctgcctgatatttccttccatcttggagacagatcctacacactcagtggctat
gcttatgtcctccagtattctgattatgggaaagagctttgtgctgtggcgttctcagct
ttcgacattcctcctcctctgggccccatctggattctgggtgctaccttcattgggcag
tactacacggaatttgaccggcagaacaaccggattggcttcgccagatctctttga

DBGET integrated database retrieval system