KEGG   Anolis carolinensis (green anole): 100557584Help
Entry
100557584         CDS       T01608                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:acs00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:acs00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:acs00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:acs00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:acs00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:acs04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 649 aa AA seqDB search
MFALFLLSLLCPALASSSSSSSVITSQRTFGIDYGHNCFLKDGQPFRYISGSIHYSRIPR
YYWKDRLLKMKMAGLDAIQTYVPWNFHEPERGVYNFTGDRDLEYFLQLAQEVGLLVILRA
GPYICAEWDMGGLPAWLLEKESIVLRSSDPDYLTAVGSWMGIFLPKMKPHLYQNGGPIIM
VQVENEYGSYFACDFDYLRYLQNLFRQYLGDEVVLFTTDGASMFYLRCGALQGLYSTVDF
GPGRNVTAAFSTQRHTEPKGPLVNSEFYTGWLDHWGHRHITVPASIVAKSLSEILASGAN
VNMYMFIGGTNFGYWNGANMPYMAQPTSYDYDAPLSEAGDLTEKYFAIREVIGMFKKLPE
GPIPPTTPKFAYGRVPLVKVGAVRELLNDLSPSGPVKSMYPLPFVQLKQYFGYVLYRTKL
PRNCTEETPLSSTFDGIHDRAYVSVDGVRQGILERSSLKKLNITGNAGADLDLLVENMGR
VNFGRFNNDFKGLISNVTLGEEILTDWEIYPLDIDRAVAEGLENKGNASSYEVPAFYIGS
FSIPSGIPDLPQDTYLTFPGWTKGQVWINGFNLGRYWPVAGPQQTLFVPSNILVASAPNN
ITVLELEESPHATQKYLVEFVDKPVFNASFHYGSSTEKLFTRELWMNYI
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccctcttcctgctctctctcctttgcccggccttggcatcatcatcatcatca
tcatccgttattacatcacagagaacttttggaattgattatggccacaactgtttcctc
aaggatgggcaaccgttccgttacatctcaggcagcatccattattcccgtattccccgg
tactattggaaagaccgcctcctgaaaatgaaaatggccggccttgatgctattcaaacc
tatgtgccatggaattttcatgaacctgagcgaggagtgtacaatttcacaggcgaccga
gatcttgaatatttcctgcagcttgctcaggaggttggcttgttggtcatactgcgagca
ggaccatatatttgtgctgaatgggacatggggggcttacctgcctggttattagaaaaa
gaatctattgtccttagatcttctgatccagattatttgacagcagtaggaagctggatg
gggattttcctaccaaagatgaagcctcacctttatcagaatggaggtccaattattatg
gtgcaggttgaaaatgaatatggaagttactttgcctgtgactttgattaccttcgttac
ctgcaaaatctttttcggcagtaccttggggatgaagttgttctatttactacagatggt
gcaagcatgttttacctgcgatgtggagctcttcaaggtctttattcaactgtggatttt
ggaccgggtagaaatgtgacagcggcattttcaacacagagacacaccgagcctaaaggc
cccttggtcaattcagagttctacactggctggctggatcattggggtcaccgtcatatc
actgtgccagcgtcaattgtagctaaaagtcttagcgagatcctggcgagtggtgctaat
gtgaacatgtacatgttcataggagggactaattttggctattggaatggagcaaacatg
ccttatatggcacagcctaccagctatgattatgatgctccactgagtgaagcaggagac
cttacagagaaatattttgccatcagggaggtaattggtatgttcaagaaattaccagag
ggccctatacctccaacaacccccaagtttgcttatggccgtgtcccactggtgaaggtg
ggtgcagtgagggagcttctcaatgatttgtcgccatcaggaccagtaaaatccatgtac
cctttaccatttgttcaattgaagcagtactttggatatgtattatacagaaccaagtta
ccaagaaactgtactgaagaaactcctctatcatcaacatttgatggaattcatgaccgt
gcctatgtctctgtggatggggttcgtcagggaattcttgaaagaagcagtctaaaaaaa
ctgaatataacagggaatgctggagcagatttggatttgttggtagaaaatatgggccga
gtaaattttggaaggttcaacaatgacttcaagggtctgatttccaatgttactcttggt
gaagaaatactcactgactgggaaatatatccattggacattgaccgtgcagtagctgag
ggcctggagaataaaggaaatgcgtcaagctacgaagtgcctgctttttatatcggtagc
ttttccattcctagtggaatccctgacttgccacaagacacctacttaacatttcctggt
tggacgaagggacaagtctggatcaatggctttaacctgggacgctactggccagtcgct
ggccctcagcaaacactgtttgttccaagcaacattcttgttgcatcggctccaaacaat
attacagttctggagctggaggagtccccacacgccacccagaaatatctggttgagttc
gtagacaagcctgttttcaacgcatcttttcactatggcagtagcactgagaagctgttc
actagagaattatggatgaattatatatga

DBGET integrated database retrieval system