KEGG   Anolis carolinensis (green anole): 100557650Help
Entry
100557650         CDS       T01608                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100557650
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100557650
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100557650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 667 aa AA seqDB search
YFRWWYRKTRLEKKQPFIDLFNSQPLRQIYGCPLGGFGGGTITRGWKGDFCRWQLNPGLY
HYKRVVADQFTVCLRRKGQTAYQQVLSVEQPSCLQGWNWSFCGHYAFYHALYPRAWSVYQ
LPGQDLVLTCRQVTPIIPHDYKETSLPVGVFVWEVENLRDEEVEVSIMFTFQNGTETKED
RRGGHWNEPFALREGGHCVRGVLLHHCLPVNGYTLAIAAREKVTMLWYTRFFGREGDACP
ALAHYMLTHYPEWEKRIEAWQRPILEDSDLPAWYKSALFNELYFLSDGGTLWVEFQPEDA
PSLAAGQGLSGLLPVLKEYGRFAYLEGQEYRMYNTYDVHFYASFALAMLWPKLELSLQYD
MAVAVLSEDPRPRVYLMNGQTAQVKLRNVVPHDIGEPDEEPWQRVNAYLIHDTADWKDLN
LKFVLQVYRDFFLTEDCTYLRDMWPVCQAVMESELKFDTDGDGLIENSGFADQTYDAWVV
TGASAYCGGLWLAAVCMMCRMAEILGEGAALQRYSAILSSGAAAFERLLWNGRYYNYDSG
GGPSSNSIMSDQLAGQWFLRACGLGEGKYQVFPQEHVQSALRTIYEMNVLGFSEGAMGAV
NGMRPDGVPDTSSVQSDEVWVGVVYSLAATMIQEGQSLAEPALAQGHLAAQMEAGPQQSG
EGGGPEV
NT seq 2005 nt NT seq  +upstreamnt  +downstreamnt
gtacttcaggtggtggtaccggaagacccggctggagaagaagcagcccttcatcgacct
cttcaactcccagcccctccgccagatctatggctgcccgctggggggcttcgggggcgg
gaccatcacccgcggctggaagggggacttctgccggtggcaactaaacccaggcctcta
ccactacaagagggtcgtcgctgaccagttcacggtgtgcctgcggcgcaagggccagac
ggcctaccagcaagtgctgtcggtggagcagcccagctgccttcagggctggaactggag
cttctgcggccactacgccttctaccacgccctctacccccgcgcatggagcgtctacca
gctgcccggccaggacctggtcctcacctgccgccaggtcacccccatcatcccccacga
ctacaaggagaccagcctcccggtgggggtcttcgtctgggaggtggagaacctgcgcga
cgaggaggtggaggtctccatcatgttcaccttccagaacggcacggagaccaaggagga
ccgccggggcggccactggaacgagcccttcgccctccgggagggcggccactgcgtccg
gggtgtcctgctgcaccactgcctcccggtcaacgggtacacgctggccatcgctgcccg
ggagaaggtcacgatgctgtggtacacgcgcttctttggccgggagggggacgcctgtcc
ggccctcgcccactacatgctgacccactaccccgagtgggagaagaggatcgaagcctg
gcagaggcccatcttggaggacagcgacctgcccgcttggtacaagtcagccctcttcaa
cgagctgtatttcctatcggacggagggaccctctgggtggagttccagcctgaagatgc
cccctccctggccgccggtcaaggcctctccggcctgctgcccgtcctcaaggagtacgg
ccgcttcgcctacctggaaggccaggagtaccggatgtacaacacctacgacgtccactt
ctacgcctcctttgcgctcgccatgctgtggcccaagctggagctcagcctccagtacga
catggcggtggccgtgctgagcgaggacccccgcccccgggtctacctgatgaacgggca
gacggcccaggtgaagctccgcaacgtggtgccccacgacatcggcgagccagacgagga
gccctggcagcgcgtcaacgcctacttgatccatgacacggccgactggaaggacctcaa
cctgaagttcgtgctgcaggtctaccgggacttcttcctcacggaggactgcacctacct
gagggacatgtggcccgtctgccaggccgtgatggagtcagagctgaagttcgacacaga
cggggacggcctgattgagaactccggctttgctgaccagacatacgatgcctgggtggt
gaccggggccagtgcctactgtggtggcctgtggctggcggccgtgtgcatgatgtgccg
catggccgagatcctgggcgaaggggccgctctgcagagatactccgccatcctgtcctc
gggcgccgccgccttcgagaggctgctctggaacgggaggtactacaactacgacagcgg
tggcgggccgtcttccaacagcatcatgtctgaccagctggccgggcagtggttcctccg
ggcctgcggcctgggagaagggaagtaccaggtcttcccacaggagcatgtgcagagcgc
cctgcggaccatctacgagatgaacgtgctgggcttctctgagggggccatgggggctgt
gaacgggatgcgcccggacggggtgcccgacacctccagcgtccagtctgatgaggtctg
ggtgggagtggtctactccttggccgccaccatgatccaagagggacaatcactggctga
accggccttagctcagggtcacctggcagctcagatggaggctgggccacagcagagtgg
ggaggggggcggacctgaagtgtga

DBGET integrated database retrieval system