KEGG   Anolis carolinensis (green anole): 100557699Help
Entry
100557699         CDS       T01608                                 

Definition
Josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100557699
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C86
   100557699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 191 aa AA seqDB search
MDGMSGNSAPNGASGIYHERQRLELCAVHALNNVLQERIFTQEAADEICKRLAPDARWNP
HRSFLGTGNYDVNVIMAALQSVGLEAVWWDKRRPLEQLSVAGVLGFIINVPSNVCLGFLS
LPVRRRHWIAVRQLDGIYYNLDSKLKAPVPIGSEADLRVFLQEVLSEGPCELLLVVPHEM
GEARDWLSTVR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggatgggatgtctgggaactcggccccaaatggagcatctgggatttatcatgagcgg
caacgccttgagctgtgtgcggttcatgccttgaataatgtcttgcaggagcggattttc
acccaagaggcagctgatgagatctgtaaaaggctggccccagatgccaggtggaatcca
catcgcagtttcctgggtacagggaactatgatgttaacgtcatcatggcagctctccaa
agtgttgggctggaagctgtctggtgggacaagcgcaggcccttagagcagctctccgta
gcaggagttctgggattcatcatcaatgtcccttccaacgtgtgcctcggcttcctatct
cttccagtgaggcgccgccactggatcgctgtgcgccagcttgatggcatctattacaat
cttgattccaagctgaaggcacctgttccgattggcagcgaagctgacctcagggtgttt
ctgcaagaagttttatctgaaggaccctgtgagttgctactagttgtgccccatgagatg
ggtgaagccagagactggctcagcactgtcaggtga

DBGET integrated database retrieval system