KEGG   Anolis carolinensis (green anole): 100557828Help
Entry
100557828         CDS       T01608                                 

Gene name
aurka
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100557828 (aurka)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100557828 (aurka)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100557828 (aurka)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100557828 (aurka)
Chromosome [BR:acs03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100557828 (aurka)
   Spindle formation proteins
    100557828 (aurka)
  Sister chromatid separation proteins
   Aurora kinases
    100557828 (aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 423 aa AA seqDB search
MEKIGKENLNGHPCHHSKAAAMGGPKRVPVAQNRIHGNKVQTQCVLTATNVPQRVPVQLQ
KPPIPSSKHSSQLNQHRPTSHVQSTSKSLNTNKATEISQPPSVSGKKPETEVLSDPKTEN
KNENKGEAKSKSETKRKQWSLDDFEIGRPLGKGKFGNVYLAREKESKFILALKVLFKSQL
EKAGVEHQIRREVEIQSHLRHPNIVRLYGYFHDATRVYLILEHAPRGEVYKELQKLSKFD
EERTATYMTELADALLYCHSKGVIHRDIKPENLLLGSKGELKIADFGWSVHAPSSRRSTL
CGTLDYLPPEMIEGRTHDEKVDLWSLGVLCYEFLVGKPPFEAETYQETYRAISKVNYKFP
PFVSEGARDLISKLLKHNPFHRLPLEEVLKHPWVNASKSPRHTIAEDIGATTTTTSTTTK
MQS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataggaaaagagaacttgaatggacatccatgtcatcacagcaaggcagct
gcgatgggtggtccaaagcgtgttcccgtggcccagaacaggatacatggaaataaggtt
caaacacaatgtgttctaacggctacaaatgttcctcagagagttcctgtccaactacaa
aaacctcctatcccaagttcaaaacactccagccagctcaatcagcaccggccaacatct
catgttcagtcaacctcaaaaagtctaaacaccaacaaagccacagaaatttctcaacca
ccttcagtgtctggaaaaaaacctgaaacagaagttttgtcagatccgaagactgaaaac
aagaatgagaataaaggagaagcaaagtcaaaaagtgaaacaaaaaggaaacagtggtcg
ctggatgattttgaaattggacgtcccttgggtaaagggaaatttgggaatgtgtacctt
gctcgtgaaaaagagagcaagttcatcctggcattgaaagtcttgtttaaatcacaattg
gaaaaagcaggagttgaacatcagattcgccgagaggtggaaatacagtcccatcttcgg
catcccaatatcgttaggttatatggctacttccatgatgcaacaagagtctacctgatc
cttgagcatgcacctcgaggggaagtatacaaagaactccaaaagctttccaaatttgat
gaggagcgaacagctacttatatgactgaactggctgatgctctattgtattgtcactcg
aaaggagtaattcatagggacataaagcctgagaacctactgctgggatcaaaaggagag
ctaaaaattgctgactttggatggtctgtgcatgctccatcctctaggaggtcaactctg
tgtggtacgcttgactacttgccaccggaaatgattgaggggagaacacatgatgaaaag
gtagacctgtggagccttggtgtcctgtgctatgagtttctggttggaaagcctcctttt
gaggctgagacataccaggaaacataccgagctatttcaaaggtcaactacaagtttcct
cctttcgtatcagaaggtgcgcgggatctgatttcgaagcttctgaaacataatccattc
cacagattgccactggaagaggtgttaaaacacccatgggtaaatgcctcaaaatctcct
aggcatacaatagctgaagacattggagctactactactaccaccagcacgaccaccaaa
atgcagtcgtag

DBGET integrated database retrieval system