KEGG   Anolis carolinensis (green anole): 100557828Help
Entry
100557828         CDS       T01608                                 

Definition
serine/threonine-protein kinase 6-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:acs04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 402 aa AA seqDB search
MGGPKRVPVAQNRIHGNKVQTQCVLTATNVPQRVPVQLQKPPIPSSKHSSQLNQHRPTSH
VQSTSKSLNTNKATEISQPPSVSGKKPETEVLSDPKTENKNENKGEAKSKSETKRKQWSL
DDFEIGRPLGKGKFGNVYLAREKESKFILALKVLFKSQLEKAGVEHQIRREVEIQSHLRH
PNIVRLYGYFHDATRVYLILEHAPRGEVYKELQKLSKFDEERTATYMTELADALLYCHSK
GVIHRDIKPENLLLGSKGELKIADFGWSVHAPSSRRSTLCGTLDYLPPEMIEGRTHDEKV
DLWSLGVLCYEFLVGKPPFEAETYQETYRAISKVNYKFPPFVSEGARDLISKLLKHNPFH
RLPLEEVLKHPWVNASKSPRHTIAEDIGATTTTTSTTTKMQS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtccaaagcgtgttcccgtggcccagaacaggatacatggaaataaggttcaa
acacaatgtgttctaacggctacaaatgttcctcagagagttcctgtccaactacaaaaa
cctcctatcccaagttcaaaacactccagccagctcaatcagcaccggccaacatctcat
gttcagtcaacctcaaaaagtctaaacaccaacaaagccacagaaatttctcaaccacct
tcagtgtctggaaaaaaacctgaaacagaagttttgtcagatccgaagactgaaaacaag
aatgagaataaaggagaagcaaagtcaaaaagtgaaacaaaaaggaaacagtggtcgctg
gatgattttgaaattggacgtcccttgggtaaagggaaatttgggaatgtgtaccttgct
cgtgaaaaagagagcaagttcatcctggcattgaaagtcttgtttaaatcacaattggaa
aaagcaggagttgaacatcagattcgccgagaggtggaaatacagtcccatcttcggcat
cccaatatcgttaggttatatggctacttccatgatgcaacaagagtctacctgatcctt
gagcatgcacctcgaggggaagtatacaaagaactccaaaagctttccaaatttgatgag
gagcgaacagctacttatatgactgaactggctgatgctctattgtattgtcactcgaaa
ggagtaattcatagggacataaagcctgagaacctactgctgggatcaaaaggagagcta
aaaattgctgactttggatggtctgtgcatgctccatcctctaggaggtcaactctgtgt
ggtacgcttgactacttgccaccggaaatgattgaggggagaacacatgatgaaaaggta
gacctgtggagccttggtgtcctgtgctatgagtttctggttggaaagcctccttttgag
gctgagacataccaggaaacataccgagctatttcaaaggtcaactacaagtttcctcct
ttcgtatcagaaggtgcgcgggatctgatttcgaagcttctgaaacataatccattccac
agattgccactggaagaggtgttaaaacacccatgggtaaatgcctcaaaatctcctagg
catacaatagctgaagacattggagctactactactaccaccagcacgaccaccaaaatg
cagtcgtag

DBGET integrated database retrieval system