KEGG   Anolis carolinensis (green anole): 100557828Help
Entry
100557828         CDS       T01608                                 

Definition
serine/threonine-protein kinase 6-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100557828
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100557828
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100557828
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100557828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 402 aa AA seqDB search
MGGPKRVPVAQNRIHGNKVQTQCVLTATNVPQRVPVQLQKPPIPSSKHSSQLNQHRPTSH
VQSTSKSLNTNKATEISQPPSVSGKKPETEVLSDPKTENKNENKGEAKSKSETKRKQWSL
DDFEIGRPLGKGKFGNVYLAREKESKFILALKVLFKSQLEKAGVEHQIRREVEIQSHLRH
PNIVRLYGYFHDATRVYLILEHAPRGEVYKELQKLSKFDEERTATYMTELADALLYCHSK
GVIHRDIKPENLLLGSKGELKIADFGWSVHAPSSRRSTLCGTLDYLPPEMIEGRTHDEKV
DLWSLGVLCYEFLVGKPPFEAETYQETYRAISKVNYKFPPFVSEGARDLISKLLKHNPFH
RLPLEEVLKHPWVNASKSPRHTIAEDIGATTTTTSTTTKMQS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtccaaagcgtgttcccgtggcccagaacaggatacatggaaataaggttcaa
acacaatgtgttctaacggctacaaatgttcctcagagagttcctgtccaactacaaaaa
cctcctatcccaagttcaaaacactccagccagctcaatcagcaccggccaacatctcat
gttcagtcaacctcaaaaagtctaaacaccaacaaagccacagaaatttctcaaccacct
tcagtgtctggaaaaaaacctgaaacagaagttttgtcagatccgaagactgaaaacaag
aatgagaataaaggagaagcaaagtcaaaaagtgaaacaaaaaggaaacagtggtcgctg
gatgattttgaaattggacgtcccttgggtaaagggaaatttgggaatgtgtaccttgct
cgtgaaaaagagagcaagttcatcctggcattgaaagtcttgtttaaatcacaattggaa
aaagcaggagttgaacatcagattcgccgagaggtggaaatacagtcccatcttcggcat
cccaatatcgttaggttatatggctacttccatgatgcaacaagagtctacctgatcctt
gagcatgcacctcgaggggaagtatacaaagaactccaaaagctttccaaatttgatgag
gagcgaacagctacttatatgactgaactggctgatgctctattgtattgtcactcgaaa
ggagtaattcatagggacataaagcctgagaacctactgctgggatcaaaaggagagcta
aaaattgctgactttggatggtctgtgcatgctccatcctctaggaggtcaactctgtgt
ggtacgcttgactacttgccaccggaaatgattgaggggagaacacatgatgaaaaggta
gacctgtggagccttggtgtcctgtgctatgagtttctggttggaaagcctccttttgag
gctgagacataccaggaaacataccgagctatttcaaaggtcaactacaagtttcctcct
ttcgtatcagaaggtgcgcgggatctgatttcgaagcttctgaaacataatccattccac
agattgccactggaagaggtgttaaaacacccatgggtaaatgcctcaaaatctcctagg
catacaatagctgaagacattggagctactactactaccaccagcacgaccaccaaaatg
cagtcgtag

DBGET integrated database retrieval system