KEGG   Anolis carolinensis (green anole): 100557963Help
Entry
100557963         CDS       T01608                                 

Gene name
lamc1
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  
laminin, gamma 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100557963 (lamc1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100557963 (lamc1)
Cell adhesion molecules and their ligands [BR:acs04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      100557963 (lamc1)
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-10 Extracellular matrix (ECM) components
     100557963 (lamc1)
    Laminin-11 Extracellular matrix (ECM) components
     100557963 (lamc1)
   MCAM, CD146; melanoma cell adhesion molecule [KO:K06534]
    Laminin-8 Extracellular matrix (ECM) components
     100557963 (lamc1)
   CXADR, CAR; coxsackievirus and adenovirus receptor [KO:K06788]
    Laminin-1 Extracellular matrix (ECM) components
     100557963 (lamc1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      100557963 (lamc1)
     Laminin-2 Extracellular matrix (ECM) components
      100557963 (lamc1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      100557963 (lamc1)
   VLA-3
      100557963 (lamc1)
     Laminin-10 Extracellular matrix (ECM) components
      100557963 (lamc1)
     Laminin-11 Extracellular matrix (ECM) components
      100557963 (lamc1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      100557963 (lamc1)
     Laminin-8 Extracellular matrix (ECM) components
      100557963 (lamc1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      100557963 (lamc1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      100557963 (lamc1)
 7. Others
  DAG1; dystroglycan 1 [KO:K06265]
   Laminin-1 Extracellular matrix (ECM) components
    100557963 (lamc1)
   Laminin-2 Extracellular matrix (ECM) components
    100557963 (lamc1)
  APP; amyloid beta A4 protein [KO:K04520]
   Laminin-1 Extracellular matrix (ECM) components
    100557963 (lamc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1602 aa AA seqDB search
MRPAVAAFPQLLLLLLLLVAARRCAGAMDECTEEEGGGGRAQRCMPEFVNAAFNATVVAT
NTCGRPPEEYCVQTGVTGVTKSCHLCDAAQPHLSHGAALLTDYNNQADATWWQSQTMLAG
AQYPSAINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWVPYQYYSGSCENTY
QKSNRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTA
TDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEYGKLSCN
CKHNTFGVDCEKCLPFYNDRPWRRATAESASECLPCNCNGRSQECYFDPELYRSTGHGGH
CTGCFGNTDGPNCQRCRENFYRLGSEEVCLPCNCNPVGSLSTQCDNYGRCSCKAGVMGDK
CDRCQPGFHSLTEAGCRRCSCDPAGSTDECNMETGRCTCKDSVEGFNCERCKPGFFNLDS
SNLRGCTPCFCFGHSSVCTNANGYSIYRITSSFQIGEEEWHAEQRDGSEMSXWISETQEI
SVISDTPFPIYFIASGKFLGNQILSYGQNLTFSFRIDRRDTRLSAEDIILEGAGLRVSVP
LIAQGNSYPSENIVKYTFRLHEATDYPWRPSLTPFEFQKLLRNLTAIKIRGTYSERNAGY
LDDVTIVSARPGPGITATWVESCTCPTGYLGQFCEQCADGYRRETPSLGPYSPCVPCFCN
GHSETCNPETGACNCRDNTAGPHCEKCSDGYYGDATTGTSSDCQPCPCPGGSTCAIVPKT
KEVVCTNCPAGTTGKRCELCDDGYFGDPLGTNGPARFCRLCQCSDNIDPNAVGNCNRLTG
ECLKCIYNTAGFYCDRCKDGFYGNPLAQNPEDKCKACNCNPYGTMNVQTSCSQVTGQCEC
LPHVTERDCSSCEPGFYNLQSGRGCERCDCHPLGSTNGHCDIQTGQCECQPGITGQRCER
CEANHFGFGREGCKPCDCDPEGSRSLQCKDDGRCECKEGFVGNRCDQCEENYFYNRSWPG
CQECPACYRLVKDKVAEQRERLQELENLIANIGTGDETITDQAFEDRLKDAERDVMDLLR
DAQSIKDVDQGLMDRLHEINRTLSSQLGRLRNIQNTVDETENLAGQAQTRVDNTQELIET
ASNMLQRARMAVANVSITPPQSTGDPNNMTVLAEEARQLATRHKEEADDIVRIAKEANDT
SSQAYQLLLDTLSGENQTMDDINDLNRKYNQAKNISRDLERQANKVHAEAEEAGNKALQI
YANLTSLPSIDTDKLENEANKIKKEARDLDQLITRKLKDYEDLREDMKGKELEVQNLLEK
GKTEQQTADQLLARADAAKALAEEAAKKGKDTLQEANDILNNLNDFDKRVNDNKTAAEDA
LKKIPAITRTILEANNKTRQAEAALGSAAADAREAKNKAGDAEKIASSVQKNAAETKADA
DKTFSIVADLDKEVDDMLQQLEDAEKELKRKQESADQDMMMAGMASQAAQEAEDNARKAK
NSVNSLLSTINDLLEKLGSVEPVDSSKLNDIEDTLNAAKKQMRDNDLDQKVSDLEKAAEK
QASAISEYNRDISTIRKDIANLEDIKKTLPTGCFNTPSIEKP
NT seq 4809 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggctgtggcggcgttccctcagctgctgctgttgttgcttcttctggtggcg
gcgaggcgctgcgcgggcgccatggacgagtgcacggaggaggagggcggcggcgggcgg
gcgcagcggtgcatgccggagttcgtgaacgcggccttcaacgccacggtggtggccacc
aacacgtgcggccgcccccccgaggagtactgcgtgcagacgggcgtcacgggggtcacc
aagtcgtgccacctgtgcgacgccgcccagccccacctgagccacggcgccgccctcctc
accgactacaacaaccaggccgacgccacctggtggcagagtcagaccatgctggccggc
gcccagtaccccagcgccatcaacctcacactccacctcggaaaggcctttgatattacc
tatgtacggctgaagttccacaccagccgaccagagagctttgccatttacaaacggacc
cgggaagatggcccatgggtgccttatcagtattacagtggatcctgtgagaacacctac
cagaaatccaatcgaggctttatcaggactggggaagatgaacagcaggcactttgcaca
gatgaattcagcgacatctctccattgacaggaggcaatgtggccttttcaactttggaa
gggaggcccagtgcttataactttgataacagccctgtcttgcaggaatgggtaactgcc
actgatatcagggtgacactcaatcgcttgaacacctttggagatgaagtttttaatgat
cccaaagttctcaagtcctattattatgcaatttctgactttgctgtaggtggcaggtgc
aagtgcaatggccatgcaagtgagtgtatgaagaatgaatatggaaaactttcctgcaat
tgcaaacacaataccttcggggttgactgtgaaaagtgcctccctttttacaatgaccgg
ccttggcgacgagcaacggcagagagtgctagtgaatgtttgccctgtaactgcaatgga
cgatcacaggagtgttattttgatcctgagctgtaccgttccaccggtcatgggggccac
tgcaccggctgctttggtaacacagatggaccaaactgtcaaaggtgccgggagaatttc
taccgtcttggcagtgaagaagtgtgtctaccatgcaattgcaatcctgttggctccctc
agcacacagtgtgacaactatggacgatgcagttgtaaagctggtgtgatgggtgacaaa
tgtgacagatgtcagcctggtttccattctctcacagaagctggttgcaggcggtgctcc
tgtgatcctgctggcagcacagatgagtgcaatatggaaacgggacgttgcacttgtaag
gacagtgtggaggggttcaattgtgagaggtgtaaacctggctttttcaacctggattcc
agcaaccttaggggatgtactccttgcttctgttttgggcattcttctgtttgtacaaat
gcaaatggatatagcatctacagaattacctcaagtttccagattggagaagaagagtgg
catgcagaacagcgagatggttctgaaatgtccnagtggatttctgagactcaggaaata
tctgtaatctcagatacaccttttcccatctatttcattgcttcaggcaagttccttgga
aatcaaatcttgagttatggtcaaaacctgacattctcttttcggatcgataggcgagac
acacgcctttctgctgaggatattattcttgaaggtgctggactgagagtatcagtccct
ctaatagctcaaggcaactcctatcccagtgagaacatagtgaagtacactttcaggctc
catgaagcaacagattatccctggaggccttctcttaccccatttgagttccagaagctg
ctccgcaatttaacagctatcaagattcgtgggacttacagtgagaggaatgctggatat
ttagatgatgtcactattgtgagtgctcggcctgggcctggaatcacagcaacgtgggtg
gaaagttgtacttgtcctacaggatatttggggcagttctgtgaacaatgtgctgatggc
tacaggagagagactcccagtctagggccttacagtccatgtgtgccatgtttctgcaat
gggcatagtgaaacctgcaaccctgaaactggagcctgtaactgcagagacaacacagca
ggtcctcattgcgagaagtgcagtgatggctattatggagatgcaactacaggaacttct
tcagattgccagccgtgtccatgtccaggagggtcaacttgtgccatcgtaccaaaaacg
aaggaggtggtgtgcactaattgcccagctggtactacaggcaaaaggtgtgaactgtgt
gacgatggctattttggagacccacttggcacaaacggtcctgccaggttttgccgcctc
tgccagtgcagtgacaacattgaccctaatgctgttgggaattgcaaccgcttgacaggg
gaatgtctgaaatgcatctacaatacagctggcttctattgtgaccggtgcaaagatgga
ttctacgggaatcccttagctcagaatccagaggacaaatgcaaagcttgcaactgtaat
ccttatggaaccatgaatgtgcagacaagctgcagtcaagtgaccggccaatgtgagtgc
ctcccccatgtgacagagcgggactgcagctcctgtgagcctggcttttacaacttgcag
agcggacgtggttgcgagaggtgtgactgccatccgttgggttccacaaatggccactgt
gacatacagactgggcagtgcgaatgccagccaggcatcactggccagcgttgtgagagg
tgtgaagccaaccattttggatttggtcgtgaaggctgcaaaccttgtgactgtgaccct
gaaggttctcgctctcttcagtgtaaagatgatggtcgttgtgaatgcaaagaaggattt
gtgggaaatcgttgtgaccaatgtgaagagaactatttttataaccgatcctggcctggc
tgtcaagagtgtcctgcctgttatagactggtgaaagataaggtggcagaacaaagggag
agattacaggaactggaaaaccttatagccaacataggaacaggtgatgaaactataaca
gaccaggcctttgaagacagactgaaagatgcagagagggatgtcatggacttgctccga
gatgctcaaagcatcaaagatgtagatcaaggtttgatggatcgcctgcatgagatcaac
agaaccctgtccagtcagcttggtaggttgaggaatattcaaaacacagtggatgaaaca
gaaaaccttgcagggcaggcccaaacccgggttgacaacacacaagaactcattgaaaca
gcttccaatatgctacagagagcaaggatggctgttgccaatgtgtctattactccacca
caatcaactggagaccccaacaatatgacagtcctggcggaagaagcccgccagctagct
acacgacacaaagaagaagcggatgacattgtccgtatagctaaggaagcaaatgataca
tcctcacaagcataccagttgctcttggacacactgtcaggagagaaccagacaatggat
gacatcaatgaccttaacagaaagtataaccaagcaaagaacatctcccgagatttggaa
aggcaggcaaacaaggtccatgcggaagcagaggaagctgggaacaaagcgctgcagatc
tatgctaatctcaccagtctgccatctatagacactgacaaactagagaatgaggcaaat
aaaatcaagaaagaagccagagatctggaccagctaatcaccagaaagctgaaagattat
gaagatctgagagaagacatgaaagggaaggagctggaggtacaaaaccttttggagaaa
ggcaaaactgaacagcagactgctgatcagctcttggctcgagcagatgctgcaaaggct
ctggctgaagaagctgccaagaaggggaaggacacgctccaggaggccaatgacattctc
aacaatttgaatgattttgataagcgtgtgaacgataacaagactgctgctgaggatgct
ctaaagaaaattcctgccattacccgtactattttggaggccaacaataagacccgtcaa
gcggaagcagcattggggagcgctgctgctgatgccagggaagcaaagaacaaagctggt
gatgctgagaaaattgctagttctgttcagaaaaatgctgctgagaccaaggctgatgct
gacaagaccttctctattgttgccgatttggacaaagaagtggatgacatgctgcagcaa
ctggaagatgctgaaaaagaactaaagaggaaacaggaaagtgcggatcaagatatgatg
atggcaggaatggcttcacaagcagctcaggaagcagaagacaatgcaaggaaagcaaag
aactctgttaacagcttactcagcacaatcaatgacctcctcgagaagttagggagtgtg
gagcctgtggattcaagtaaactgaatgatattgaagataccttaaatgctgccaaaaaa
cagatgagggacaacgatctggatcaaaaagtgtctgatctagagaaagcagcagaaaag
caagccagtgccatcagtgaatacaacagggacattagcaccatcaggaaagacattgcc
aatctagaggacatcaagaagaccttaccaactggctgtttcaacaccccgtccattgaa
aaaccctaa

DBGET integrated database retrieval system