KEGG   Anolis carolinensis (green anole): 100557993Help
Entry
100557993         CDS       T01608                                 

Gene name
usp20
Definition
(RefSeq) ubiquitin specific peptidase 20
  KO
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100557993 (usp20)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100557993 (usp20)
Ubiquitin system [BR:acs04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100557993 (usp20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 925 aa AA seqDB search
MGDLREACPHLDSIGEVTKEDLLLKSKGTCQSCGAGGPNLWACLQVGCPYVGCGESFADH
STLHAQAKKHNLTVNLTTFRVWCYACEKEVFLDQRLASPSPAPPSKCGEQDSPPPAHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPSSLSHGIKLVNPSFRGYAQQDTQEFLRCLM
DQLHEELKEPVAAEVRDLEASEADDKREGDRSPSEDEFLSCDSGSSDRGEGDGQAGKAGG
TGMPEAELLIQDEAGRGISEKERLKDRKFSCSHQRSHSEQVDEDADVDTSVETGTEGRAS
PDILQPPTPRPASPARTPEPDNEAYSRCSSRPCSPVHHHDVHAKLSSSPPRSSPVRLGPS
YVLKKAQMLASGKKRKELRYRSVISDIFDGSILSLVQCLTCDRVRFLTSADPVSTTVETF
QDLSLPIPGKEDLAKLHSAIYQNVPAKTGSCAGDNYAASQGWIAFIVEYIRRFVVSCIPS
WFWGPVVTLEDCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFR
HEVMYSFKISSHVSFPLEGLDLRPFLAKESASQVTTYDLLSVICHHGTAGSGHYIAYCQN
VINGQWYEFDDQYVTEVHETVVQNAEAYVLFYRKSSEEAVRERQKVVSLATMKEPGLLQF
YISREWLNKFNTFAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEYLYNRFGG
GPAVNHLYVCSVCQVEIEALAKRRKMEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEA
FVKGKDNAEPPGPIDNSKIAVAKGSGHVQVKPGADYGQISEETWIYLSTLYGGGPEIAIR
QNVAQVQEVETLHGEQKIEAETRAA
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacctgagagaggcctgtcctcacctggactccataggagaagtgaccaaggaa
gatctgctcctcaaatccaagggaacatgccagtcttgcggcgccggaggacccaacctg
tgggcctgccttcaggtcggttgcccttacgtcggttgcggggagtcttttgccgaccac
agcactcttcatgcgcaggccaaaaagcacaacctgacggtcaacctgaccacgttccgc
gtctggtgttacgcctgcgagaaagaggttttcctggaccagcgactggcttctccctcg
ccagccccaccctcaaaatgcggggaacaggattctcctcccccggcgcatcctctaaag
gccgttccgattgcggtggccgatgaaggggagtcggagtcagaagacgacgacctcaaa
ccgagaggccttacaggaatgaagaacctcggcaactcctgttacatgaatgcggcgctt
caggccctttcgaactgccccccgctcacacagttcttcctcgaatgcggaggcctggtg
cgcacagacaagaagccggcgctctgcaaaagttaccagaagctggtttcggaagtctgg
cacaagaagcggccgagttacgtggtcccgagcagcctgtcccatggcatcaagctggtc
aatccgagtttccgaggctatgcccaacaggacacccaggagttcctccgctgcctgatg
gaccagctccacgaggagctgaaggagcccgtggcggccgaggtgcgggacttggaggcg
agcgaggcggacgacaagcgggagggcgaccgcagcccctccgaggacgagttcctgtcc
tgcgactccggcagcagcgaccggggcgaaggcgacgggcaggccggcaaggccgggggc
acgggaatgccggaagcggagctgctgatccaggacgaagccgggcgagggatctccgag
aaggagcggctcaaggaccggaagttctcctgcagccaccagcgcagccactcggagcaa
gtggacgaggacgccgacgtggacacctccgtggagaccggcaccgagggcagggcttct
ccagacatcctccagccgcccaccccacgaccggccagcccggccaggactcccgagccg
gacaacgaggcctattcccgctgctcctcccggccctgcagccccgtccaccaccacgac
gtccacgccaagctctccagcagccccccgcgctccagccccgtgcggttgggaccctcc
tacgtgctgaagaaggcccagatgctggcgtccggcaagaagaggaaggagctccgctac
cgcagcgtcatctccgacatctttgacggctccatcctgagcctggtgcagtgcctcacc
tgtgaccgagtgcgtttccttacctctgcggacccagtctctaccacggtggagaccttc
caggacctgtctctgcccatcccgggcaaggaggacctggccaagctgcactcggccatc
taccaaaacgtcccggccaagacgggctcctgcgcgggggacaactacgccgcctcgcag
ggctggatcgccttcatcgtggaatacatacgcagatttgtggtgtcctgcatccccagc
tggttttggggtccggtggtcaccttggaggactgcctcgccgccttctttgctgccgac
gagctcaaaggcgacaacatgtacagctgcgaacgatgtaaaaagttgagaaatggggtc
aaatattgcaaagttctccggctccctgagatcctgtgcatccacctgaagcgcttccgg
cacgaggtgatgtactcgttcaagatcagcagccacgtctccttcccgctggaagggctg
gacctccggccattcctggccaaggagagcgcctcccaggtcaccacctacgacctcctc
tcggtcatctgccaccacggcacggccggcagcggacattacatcgcctactgccagaac
gtcatcaacggccagtggtacgagttcgacgaccagtacgtcaccgaagtgcacgagacg
gtcgtccagaacgccgaggcctacgtcttgttctacaggaagagcagcgaggaggccgtc
cgggagcggcagaaggtggtctccttggccaccatgaaggagcccggcctgctccagttc
tacatctcccgggaatggctcaacaagttcaacaccttcgccgagccgggccccatcacc
aaccacaccttcctctgctctcatgggggaatcccgccaaacaagtaccactatatcgac
gacctggttgtgatccttccccagaacgtctgggagtatctctacaacagattcggaggc
ggtccagccgtgaaccacttgtacgtctgttcggtgtgccaagtagagatcgaagccttg
gccaagcggaggaagatggagattgacacctttatcaagctcaacaaggccttccaagcg
gaggagtcccccggggtcatctattgcatcagcatgcagtggttccgcgagtgggaggcc
tttgtcaaaggcaaagacaacgcagagcctcccgggcccatcgacaacagcaagatcgcc
gtggccaaaggaagcggccacgtccaggtgaagccaggagccgattacggccagatctcc
gaggagacgtggatctacctcagcacgctctacggcggggggcccgagatcgccatccgg
caaaacgtggcccaagtgcaagaagtggagaccctccacggggagcagaagatcgaggcc
gagacccgggcggcctga

DBGET integrated database retrieval system