KEGG   Anolis carolinensis (green anole): 100558003Help
Entry
100558003         CDS       T01608                                 

Gene name
hexdc
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100558003 (hexdc)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100558003 (hexdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 472 aa AA seqDB search
MASSPFELHLVHLDLKGAPPKVSYLAEVFPLFHALGANGILLEYEDMFPYDGELKPLCAN
DAYSTSEIKEILKLANFHELEVIPLIQTFGHMEFVLKHKEFCHLREVAMFPNTVNPHKEE
SLRLVCTMVDQVVALHGDLRWLHIGCDEVYYLGEGEESKEWLKQGENTIEKLCLAHMKAV
ASHVISAHPTVKPIVWDDMLRGMNEETLRDSGIAQLIELMIWDYSPDLEVDIKVNLIEKY
LKSDFSKLWFASAFKGATGVNQCLTVIGPHLKNHQQWLKVAASIPAGTIQGITLTGWQRY
DHLSVLCELLPAGIPSLAVCLQTLKNDSYSEKVKEDVEKLLGISSLEIDTFMSDISGTFP
GSEILSLVTQIAFYLKSSVDELLENNRYVTGWFSPYHRKRKKIHPIMIHHFQPDALRLLN
KWTAVTQELCKAMEKVFYASAIEEWMEENVHPSLQRLQATVDDLDKAIQALS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctccctttgaactgcacctggtgcacttggacctcaagggagcgccacca
aaggtctcatatctggcggaggtcttcccattgtttcatgccctgggtgcaaatggcatt
ctcttggaatatgaagatatgtttccttatgatggcgaactgaagccactctgtgcaaat
gatgcatacagtacatcagagattaaagaaattctaaagctggcaaacttccatgagtta
gaggttatccctctcatacagacatttggacacatggagtttgttctgaaacacaaagaa
ttttgtcatctgcgggaagtagcaatgttccccaacactgtgaatccacacaaagaagaa
tccctgagactggtttgcaccatggtagatcaggtggtagccctgcatggtgatcttcga
tggcttcatattggctgtgatgaggtgtactaccttggtgaaggggaagaatccaaggag
tggttgaagcaaggagaaaatactattgagaagctctgcctggcccacatgaaagcagtg
gccagccatgtaatctctgcccatcccacagtaaagccaattgtgtgggatgacatgttg
aggggaatgaatgaggaaacactgagagattctggcatagcacaacttatagaattgatg
atctgggactactcccctgatcttgaagtggacattaaagtaaatcttatagaaaaatac
ctgaagagtgacttttcaaagctctggtttgcaagcgcttttaaaggggccactggtgtg
aaccaatgcttaacagtcattggaccccaccttaaaaaccaccagcagtggctgaaagtg
gctgcgagcatccctgcaggcaccatccaagggatcacattgactggctggcaaaggtat
gaccacttgtctgttctgtgtgagcttctgcctgcaggaatcccatccctagctgtatgt
ctccagacactgaagaatgatagctattcagaaaaggtaaaagaagatgttgaaaaactc
ctggggatctccagtttggaaatagacactttcatgagtgacatctcagggactttcccc
ggaagtgaaattctctcacttgtgacccaaattgcattctacctcaaatcttcagtggat
gaacttttggaaaacaacaggtatgtcacaggctggttcagcccttaccacagaaagaga
aagaagatccatcctataatgattcatcattttcagccagatgcattaaggcttctgaac
aaatggactgctgtgacacaggagctctgtaaagccatggaaaaggtcttctatgcatct
gcaattgaagaatggatggaggagaatgtccaccccagcctgcaaagacttcaagccaca
gtagatgatctggataaagcaatacaagcactttcatag

DBGET integrated database retrieval system