KEGG   Anolis carolinensis (green anole): 100558062Help
Entry
100558062         CDS       T01608                                 

Gene name
abhd12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100558062 (abhd12)
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100558062 (abhd12)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100558062 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 375 aa AA seqDB search
MRKRNESVTLESSSPPLEKGFSLRTSLRLPGSDGMKRTLGRRHGMWFRFRKVVMWLLGVY
IAIPFLVKVCPAIQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVTIGVWHT
VPAVLWKDAQSKDQPWYEDILGSNHPVILYLHGNAGTRGGDHRVELYKVLSSLGFHVVTF
DYRGWGDSIGTPSESGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERE
TPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISC
SLLILHAEDDPVVPFHLGKKLYNIAAPSRSFRDFKVQFVPFHTDLGYRHKYIYKSPELPR
ILREFMGKSEHKHHH
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcggaatgagtccgtcacgttggagtcctcctctccgcctctggagaagggt
ttcagcctgaggacgagcctgcgtttgccgggcagcgacggcatgaagcggacgctcggc
aggagacatggaatgtggtttcggtttcggaaagtagtaatgtggttgttgggagtgtac
atagccattccatttctagtaaaagtctgtcctgctattcaggcaaagctcgtcttcctg
aattttgtgagagtaccctatttcattgacttgaaaaggccccaggaccaaggattaaac
cacacctgtaactattacttgcaaccagaggaagatgtaaccattggagtctggcacaca
gttcctgcagtgctatggaaggatgctcaaagcaaggatcagccatggtacgaagacatt
ttgggttctaatcaccctgtgatcctttacttacatggaaatgcaggaaccagaggaggc
gatcatcgtgtagaactgtataaggttttaagttcacttggtttccacgtagtcacattt
gattatcgaggttggggagactcaataggcactccctcagagagtgggatgacctatgat
gctcttcatgtttttgactggataaaagcaagaagtggagataacccagtttatatatgg
gggcactctttaggcactggagtcgcaaccaacctagtgaggcgtctttgtgaaagagaa
actccccctgatgctttgatcttggaatctccctttacaaacatacgcgaagaagcaaaa
agccacccctttagtgtaatatatagatatttcccaggatttgactggtttttccttgat
cccataacatcaagcggaattaagtttgcaaatgatgaaaacgtgaagcacatttcatgt
tctctgcttattcttcatgctgaagatgatcctgtagttccatttcatcttggaaaaaag
ctgtacaacattgcagccccatctcggagctttcgtgatttcaaagtccagttcgttcca
tttcacacagatctaggttacaggcataaatatatctacaagagcccagaactacctcga
atattaagggaattcatggggaaatctgaacataagcaccatcactga

DBGET integrated database retrieval system