KEGG   Anolis carolinensis (green anole): 100558069Help
Entry
100558069         CDS       T01608                                 

Gene name
adcy6
Definition
adenylate cyclase 6
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Purine metabolism
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100558069 (adcy6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100558069 (adcy6)
  Cellular commiunity
   04540 Gap junction
    100558069 (adcy6)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100558069 (adcy6)
   04914 Progesterone-mediated oocyte maturation
    100558069 (adcy6)
   04916 Melanogenesis
    100558069 (adcy6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100558069 (adcy6)
   04270 Vascular smooth muscle contraction
    100558069 (adcy6)
Enzymes [BR:acs01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100558069 (adcy6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1094 aa AA seqDB search
MSWFSGILVPKVDERKTAWGERNGPKRHRPALCGPRYMSCLQDPELERGGSGGLGLNCSW
QEDHYGKKQPLSPPPPASGAGDLGLKAVDLGFEDSGGTAAETKGFSARDCGRRLLHVFRS
KRFQSAKLERLYQRYFFQMNQSSLTVLMGVLVLACGIMLVFHCVPGSPRVPYAAALAVAA
ALFLSLMFLCNRTSFHQDCMWAVSYLVIGALCGVQALGTLLVSPRSASEGVWWSVFFIYI
IYTLLPVRMRVAVLAGALLSVLHLVISWHLNKTDSFLWKQLAANSLIFLCTNVIGICTHY
PAEVSQRQAFQETRGYIQARLHLQRENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFH
KIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGD
CYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLR
KWQFDVWSNDVTLANQMEAGGKAGRIHITQATLQYLNEDYEVEPGHGGERNAYLKEHNIE
TFFIVGCSQKRKEEKAILAKLQRAQANSTEGLVPRWVPERSFPRTKDSKAFRQMGIDDAS
KDNRSTQEALNPEDEVDEFLGRAIDARSIDQLRKDHVKRFLLTFQKPELERKYSKKVDTR
FGGYVACTVLVFCFICCIQIVIFPHSGLMLGAYISIFSILITILFVCAIYSCLGPFPATL
QRVSRKIIQSRINSTITGVTAILLVFISAFINMYFTYSVLLSLLASSVFLHISSLGKLAL
LVGMEVVYLALAEGPQRVLFDNYDLLVVANAFIAEGKVALQYMTPVILLLFALALYLHSQ
QVESTARLDFLWKQQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERLNDELYHQS
CECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISDEPFKQLEKIKTIG
STYMAASGLNDSTYDREGRSHITALADYAMRLMEQMKYINEHSFNNFQMKIGLNIGPVVA
GVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLEFRGVVKVKGK
GEMTTYFLNGGPTS
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggtttagtggcatactggtgcccaaagtggacgagcggaagactgcttggggg
gagcggaatgggcccaagcgccatcgcccagcgctctgcggcccgcgctacatgagctgc
ttgcaggacccggaactggagcgaggaggcagtgggggacttgggctcaattgttcgtgg
caggaggaccactatggcaagaagcagccgctgtcacctccaccgcctgccagcggggca
ggggacttggggctcaaagccgtggacttgggctttgaggacagtgggggaactgcggcg
gagaccaaggggttctcggccagggactgtggccggcgcctcctgcacgtgttccgatcc
aagcgtttccagtcagccaagctggagcgcctctaccagcgctacttctttcagatgaac
cagagctcgttgactgtgctcatgggagtcttggtgctggcttgtggcatcatgctggta
ttccactgtgtgcctggcagccctcgtgtgccgtacgctgccgccctggctgtagcagcc
gccctcttcctctcccttatgtttctgtgcaaccggaccagcttccatcaggactgcatg
tgggctgtgagctacctagtcatcggggcactgtgtggggtgcaggctctgggcaccctt
ctggtctcgccacgaagtgcctccgaaggggtctggtggagcgtcttcttcatctacatc
atctatactctcctgcctgtacgcatgcgggtggctgtgctggctggagccttgctctcg
gtgcttcatttggtcatctcttggcatctaaacaagacagactcctttctttggaaacag
cttgctgccaatagtttgatcttcctctgcaccaatgtcatcggcatctgcactcactac
ccagctgaagtgtctcagcgccaagcctttcaagagacccgtggttacattcaagctcga
ctacatctccagcgagaaaaccggcagcaggaacgactccttctctcagtgctgcctcag
catgttgcaatggagatgaaagaggacatcaacaccaaaaaggaagacatgatgttccac
aaaatctacatccagaaacatgacaatgtcagcattttgtttgctgacattgagggattc
acgagcctggcctcgcagtgcacagcacaagaactggtcatgacgctgaatgagcttttt
gcccgtttcgacaagttggctgcggagaatcattgcctgcgcatcaagatccttggggat
tgctactattgtgtctcagggctgccggagccacgggcagatcatgcccactgctgcgta
gagatgggtgtggacatgattgaggccatttcgctggtgcgtgaagtgaccggggtgaat
gtgaacatgcgtgttgggatccacagcgggcgtgtgcattgtggagtgctggggctgcgc
aagtggcagtttgatgtctggtccaatgacgtcaccctggccaaccaaatggaggctggt
ggcaaagctgggcggatccacatcacccaggcaacactgcagtacctgaatgaggactac
gaagtggaaccagggcacgggggcgaacgcaatgcctacctcaaggagcataacatcgaa
accttcttcattgtgggctgcagccagaaacgaaaagaggagaaagccatcttggccaag
ctgcaaagggctcaggccaattccaccgaggggctggtgcctcgctgggtccctgaacgc
tcgtttcctcggactaaggactccaaggctttccggcagatgggtattgatgatgccagt
aaggacaatcgaagcacccaggaagccttaaaccccgaagatgaggtagatgagtttctg
ggtcgtgccatcgatgcccgaagtattgaccagctgcgcaaggatcatgttaagcgcttc
ctgctgactttccagaaacctgagttggagagaaagtattccaaaaaggtagatacccgt
tttgggggctatgtggcttgcaccgtgctggtcttctgcttcatatgctgtatccagatt
gtcattttccctcactccggtctgatgcttggtgcctacatcagcatcttcagcatcctg
atcaccatcctttttgtgtgtgccatctactcttgccttgggccctttccagccactttg
cagcgtgtttcccgcaagatcatccagtcccgaattaacagcacaatcacaggtgtcact
gccatcctgcttgtgttcatctcagctttcatcaacatgtacttcacatactcagtgctg
ctgagtctgctggcctcctccgttttcctgcacatcagtagccttgggaagctggcgctg
ctggtggggatggaagttgtgtacctggccctggcggagggtccccaaagagtgctgttt
gacaactatgacttgttggtggttgcaaacgcctttatcgcagagggcaaagtggccttg
cagtacatgactcctgtcatcctcctcctttttgcactggcgctctatctgcattcccag
caggtggagtccacagcccgtctagacttcctctggaaacaacaggctacaggtgagaaa
gaagagatggaagaattgcaggcctacaaccgccggctgctgcacaacatcctgcccaaa
gacgtagccgcccacttcttggctcgtgagcgcctcaacgatgagctgtaccaccagtca
tgcgaatgtgtggctgtcatgtttgcctcaatcagcaacttctccgagttctacgttgag
ctggaagccaacaacgagggtgttgaatgtttgcggctgctcaatgaaattattgccgat
ttcgatgagatcattagtgatgaacctttcaagcagctggagaagatcaagacaattggc
agcacctatatggcagcttcagggctgaatgacagcacctatgaccgtgaagggcgctcc
catatcacagctctggccgactatgcgatgcgactcatggagcagatgaaatacatcaac
gagcactctttcaacaacttccaaatgaaaattggactaaacattgggccagtggtggca
ggggtgattggagcccgaaaaccacagtatgacatctggggcaacaccgtgaatgtctcc
agccgtatggatagcactggtgtccctgaccgcattcaggtgacaactgacctctatcag
gtattggcagccaaaggttaccagctggagtttcgtggagttgtcaaagtcaaaggcaaa
ggcgagatgaccacctatttcctgaatggtggccctaccagttag

DBGET integrated database retrieval system