KEGG   Anolis carolinensis (green anole): 100558154Help
Entry
100558154         CDS       T01608                                 

Gene name
gemin7
Definition
(RefSeq) gem (nuclear organelle) associated protein 7
  KO
K13135  
gem associated protein 7
Organism
acs  Anolis carolinensis (green anole)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100558154 (gemin7)
Spliceosome [BR:acs03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100558154 (gemin7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
f
AA seq 126 aa AA seqDB search
MKVPVAVIRLPRGPDGSSRGFDPNSLRFQELGPASLSSMGRGNTADLELEQQSRVTLRER
YLRSLLAMAGRPVHFTMHERVSITALFRASDIDILNFQVSELQTPLGIQREALLRCSDII
AYSFEL
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttccagttgctgttattcgtctgccccgcggacctgatgggtcaagtcgtggc
tttgaccccaactctctccgtttccaagagctgggccctgccagcctctcctccatgggt
cgtgggaacacagcagacctggaattggagcagcaaagccgagtgacgctgcgggaacgc
tacctgcgcagcctcttggctatggctgggcggcccgtccacttcaccatgcatgagagg
gtgagcatcaccgcgttgtttagagcctcagacattgacattctgaacttccaggtttct
gaactgcagactccgctggggatacagagggaagccctcctccgctgctcggacatcatt
gcatactcttttgagctgtga

DBGET integrated database retrieval system