KEGG   Anolis carolinensis (green anole): 100558182Help
Entry
100558182         CDS       T01608                                 

Definition
acrosin-like
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     100558182
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100558182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 526 aa AA seqDB search
MTTSQTQPPPMKPPSVHLVPPKVQSQKEVQSKGKEDITGMLVSPTVTTKATPSTTWYQVP
RPKPPRRKTEMVVSSAQWSNRGICGRRPLAPSHGGSVRIIGGTDTLPGTWPWIVSIQTPS
HRGYTHICGGSLISSRWVVTAAHCFLDKRFMEHWKLVIGATQLSRHSPDIQERTIKNLIE
HQQYQKHNHLNDIALLELSQPINCTDYIQIACLPDSDVDVPALTHCYISGWGVTDLSRRQ
TSDILQEAKVNLIPLELCNSTYWYNSKIHFNNLCAGYQRGGIDSCQGDSGGPLMCRGVRS
ERFWVVGVTSWGAGCGRAQRPGVYTSTQHFLDWIRAGTKEKLTRPGGQATVKPKPNMPRP
VGKPWYQVANLPTTNAPMGNWINPWPVPTPIPSSPPLTWQEPTLPKDEQEIQNWLHAHAT
PRPPPLPPPLPPPQPTPTPPPPPPPPPLPFQTHPPPRPAYQTWAQVGLTRPTRRTTRHPA
YYSVQQGYQDWYRPPPATQPPTTQQWAWAQPTWSQYWRPKRTRNPY
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatctcaaacgcagccccctcccatgaagcccccctcggtgcatttagtgcca
ccgaaggtccagtcgcagaaggaagtccagtccaaaggaaaggaggatatcacgggtatg
ttagtctctccaacggtgaccacaaaggcgaccccttccaccacctggtaccaagtccca
cggcccaagccgcctcggcgcaagacggagatggtggtgtccagcgcccagtggagcaac
cgtgggatttgcgggcggcgtcccctggctcccagccacggcggttcggtgcggatcatc
ggtggcacggacaccttgccaggaacatggccctggatcgtcagcatccagaccccgtcg
caccgaggctacacccacatctgcggagggtccctcatcagctcgcgttgggtggtcacc
gcggcccattgcttcttggataagaggttcatggagcattggaagctggtgatcggggcc
acgcagctctcccggcacagccccgacatccaggagcgcaccatcaagaacctgatcgag
caccagcagtaccagaagcacaaccacctcaacgacatcgccctcctggagctgagccag
cccatcaactgcaccgactacatccagattgcctgcctcccagacagcgacgtggacgtc
cccgccttgacccattgctacatcagcggatggggggtcaccgacctctccaggcgccag
acgtccgacatcttgcaggaggccaaggtcaacctcatcccgctggaattatgcaacagc
acttactggtacaacagcaagatccacttcaacaacctttgtgctgggtatcagcgcgga
gggatcgattcctgccagggtgacagcggtggccccctaatgtgccggggtgtgaggtct
gagcgcttctgggtggttggcgtcaccagctggggggccggctgcgggcgggcccagcgt
ccgggcgtctacacctccacgcagcacttcctcgactggatcagagcgggcaccaaagag
aagctaacccggccgggcggccaggcaaccgtgaagcccaagcccaacatgccaaggcct
gtggggaaaccgtggtaccaggtggcaaaccttccaaccacgaatgcccccatggggaac
tggatcaacccatggcccgtgccgaccccaataccgagcagccccccgctgacgtggcag
gagcccaccttgcccaaagacgagcaggagatccagaactggctccacgcccatgccacc
ccaaggcccccgcccctgcccccgcccctgcccccaccccagcccacccccactcctcct
cctcctcctcctcctcctcctcttcccttccaaactcatcccccaccacggccggcctac
cagacgtgggcccaggtgggcctgacccggcccaccaggaggaccacccggcaccctgcc
tactacagcgtgcagcagggctaccaggattggtaccggcctcccccagccacccagccc
cccacaacccagcaatgggcatgggcccagcccacatggtcccaatactggcgtcccaaa
aggaccaggaatccctactag

DBGET integrated database retrieval system