KEGG   Anolis carolinensis (green anole): 100558195Help
Entry
100558195         CDS       T01608                                 

Gene name
pold4
Definition
(RefSeq) polymerase (DNA-directed), delta 4, accessory subunit
  KO
K03505  
DNA polymerase delta subunit 4
Organism
acs  Anolis carolinensis (green anole)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100558195 (pold4)
   00240 Pyrimidine metabolism
    100558195 (pold4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100558195 (pold4)
   03410 Base excision repair
    100558195 (pold4)
   03420 Nucleotide excision repair
    100558195 (pold4)
   03430 Mismatch repair
    100558195 (pold4)
   03440 Homologous recombination
    100558195 (pold4)
DNA repair and recombination proteins [BR:acs03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100558195 (pold4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 110 aa AA seqDB search
MGRKRLITDSFQVVKRKRRSKERKECQIPTHDTAQAESSLQDAAQPDQVELLKHFDLSWE
YGPCTGITRWQRWERAELLGLHPPVTVRELLLKYSKDPLVIHSVWYEYSL
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggaagcgactcatcacagactcattccaagtggtgaagaggaaaagaaggagt
aaagaaagaaaggaatgtcaaatcccaacccacgacacagcccaagcagaatcttccttg
caagatgctgcacagccagaccaagtggagttattgaagcattttgacctcagctgggaa
tatggtccttgcacaggaatcacccgttggcagcgctgggagagagcagagttgttgggt
cttcatccccctgtcaccgtgagggaactactgctgaagtacagtaaggacccccttgtt
atacacagcgtgtggtatgaatactccctctga

DBGET integrated database retrieval system