KEGG   Anolis carolinensis (green anole): 100558272Help
Entry
100558272         CDS       T01608                                 

Gene name
prkx
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100558272 (prkx)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100558272 (prkx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 359 aa AA seqDB search
MEALSAVRAKVGARSPGGCEAVGSGEPQALPAAGPTPPLEPAAGYRLEDLETLATVGTGT
FGRVHLVKEKSAKTYFALKVMSIPDVIRLKQEQHVHNEKSVLKEVNHPFLIRLFWTYHDE
RFLYMLMEYVPGGELFSYLRNMGRFNNSTGLFYSAEIICAIEYLHSKEIVYRDLKPENIL
LDKEGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLS
GFPPFFDDNPFGIYQKILAGKIDFPRHLDLYVKDLIKKLLVVDRTRRLGNMKNGADDVKR
HRWFRSVDWDAVPQRKLKPPIVPKVSNDGDTSNFEAYPEDDWNKTPPVPPKDLEIFQNF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctgagcgccgtgcgggccaaagtgggggccaggagccccggcggctgcgag
gcggtgggcagcggcgagccccaagccttgcctgcagccggccctacgccgccgttggag
cccgccgccgggtatcgcctggaggacctggagaccttggccactgtgggaacaggtact
tttgggcgggttcatctggtgaaagagaaatcagccaaaacctactttgcattgaaagta
atgagcattccagatgtcattcgactaaaacaagaacagcatgtgcacaatgaaaaatcg
gtcttgaaagaagtgaatcatccatttctgatcagattattttggacttaccatgatgaa
cgctttctatatatgttgatggaatatgtacctgggggtgaactttttagttatctgcgc
aacatgggacgctttaataacagcactggactgttttattctgcagagattatttgtgca
atagaatatctccattcaaaggaaatagtttacagagacttaaagcctgaaaatatctta
ttggacaaagaggggcatatcaaactcacagactttggatttgctaaaaaactggttgat
aggacatggaccttatgtggaactccagagtatcttgccccagaagttatacagagtaaa
ggccatggaagagcagtggactggtgggccctgggtattctgatatttgaaatgttgtct
gggtttcctccattttttgatgataacccatttggaatatatcagaagattcttgctggc
aaaatagattttcccagacatctggatttatatgtaaaggaccttattaaaaagcttctt
gtggttgacagaacgaggcggctggggaatatgaagaatggagctgatgatgtgaagcgg
catcggtggtttaggtctgttgactgggatgctgtaccacaaaggaaattaaagcctcct
atagtgccgaaagtatcaaatgatggtgacacatcaaattttgaagcttatcctgaagat
gactggaacaaaacacctcctgtacctcctaaagatttagaaattttccaaaacttctaa

DBGET integrated database retrieval system