KEGG   Anolis carolinensis (green anole): 100558272Help
Entry
100558272         CDS       T01608                                 

Definition
serine/threonine-protein kinase PRKX-like
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100558272
   04310 Wnt signaling pathway
    100558272
   04340 Hedgehog signaling pathway
    100558272
   04020 Calcium signaling pathway
    100558272
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100558272
   04210 Apoptosis
    100558272
  Cell communication
   04540 Gap junction
    100558272
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100558272
   04912 GnRH signaling pathway
    100558272
   04914 Progesterone-mediated oocyte maturation
    100558272
   04916 Melanogenesis
    100558272
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100558272
   04270 Vascular smooth muscle contraction
    100558272
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100558272
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100558272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 359 aa AA seqDB search
MEALSAVRAKVGARSPGGCEAVGSGEPQALPAAGPTPPLEPAAGYRLEDLETLATVGTGT
FGRVHLVKEKSAKTYFALKVMSIPDVIRLKQEQHVHNEKSVLKEVNHPFLIRLFWTYHDE
RFLYMLMEYVPGGELFSYLRNMGRFNNSTGLFYSAEIICAIEYLHSKEIVYRDLKPENIL
LDKEGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLS
GFPPFFDDNPFGIYQKILAGKIDFPRHLDLYVKDLIKKLLVVDRTRRLGNMKNGADDVKR
HRWFRSVDWDAVPQRKLKPPIVPKVSNDGDTSNFEAYPEDDWNKTPPVPPKDLEIFQNF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctgagcgccgtgcgggccaaagtgggggccaggagccccggcggctgcgag
gcggtgggcagcggcgagccccaagccttgcctgcagccggccctacgccgccgttggag
cccgccgccgggtatcgcctggaggacctggagaccttggccactgtgggaacaggtact
tttgggcgggttcatctggtgaaagagaaatcagccaaaacctactttgcattgaaagta
atgagcattccagatgtcattcgactaaaacaagaacagcatgtgcacaatgaaaaatcg
gtcttgaaagaagtgaatcatccatttctgatcagattattttggacttaccatgatgaa
cgctttctatatatgttgatggaatatgtacctgggggtgaactttttagttatctgcgc
aacatgggacgctttaataacagcactggactgttttattctgcagagattatttgtgca
atagaatatctccattcaaaggaaatagtttacagagacttaaagcctgaaaatatctta
ttggacaaagaggggcatatcaaactcacagactttggatttgctaaaaaactggttgat
aggacatggaccttatgtggaactccagagtatcttgccccagaagttatacagagtaaa
ggccatggaagagcagtggactggtgggccctgggtattctgatatttgaaatgttgtct
gggtttcctccattttttgatgataacccatttggaatatatcagaagattcttgctggc
aaaatagattttcccagacatctggatttatatgtaaaggaccttattaaaaagcttctt
gtggttgacagaacgaggcggctggggaatatgaagaatggagctgatgatgtgaagcgg
catcggtggtttaggtctgttgactgggatgctgtaccacaaaggaaattaaagcctcct
atagtgccgaaagtatcaaatgatggtgacacatcaaattttgaagcttatcctgaagat
gactggaacaaaacacctcctgtacctcctaaagatttagaaattttccaaaacttctaa

DBGET integrated database retrieval system