KEGG   Anolis carolinensis (green anole): 100558273Help
Entry
100558273         CDS       T01608                                 

Gene name
gk
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100558273 (gk)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100558273 (gk)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100558273 (gk)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100558273 (gk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 639 aa AA seqDB search
MGSPAHSLFCPRLPGVLIGCESAACWPAPPFQPRSHARRQKQEPEIGKGAGARRERQCGG
VAGVAGVALETGRGRADGRLAMAAGVGAQGGAMGPLVGAIDQGTSSTRFLVFNANTSELL
SHHQVEIQQKFPKEGWVEQDPVEILQSVYECVERTCEKLNQLNVDIANIKAVGVSNQRET
TVVWDKLTGEPLHDAIVWLDLRTQPTVERLLKRIPGQNKSFLKSKTGLPLSTYFSAVKLR
WLLDNVPKVKQAVLNRRALFGTIDSWLIWSLTGGKDGGIHCTDVTNASRTMLFNIHSLEW
DEELCKFFEIPMEILPKVRSSSEIYGLMSSGALTGIPISGCLGDQSAALVGQMCFKDGQA
KNTYGTGCFLLCNTGQKPALSEHGLLTTVAYKLGREKPVYYALEGSVAIAGAVVRWLRDN
LGIARSSDEIEKLAADVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKNHIAFA
ALEAVCFQTREILDAMNKDCGIPLSQLQVDGGMTNNKILMQLQADILCIPVVKPSMPETT
ALGAAMAAGAAEGVGVWSLNLDDLTAVTCECFEPKINPEESEYRYRRWKKAVKKSMGWET
SEPQESGETSIFCSLPLGFFVMSSLLMLIGAKYISAYCK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgggaagccccgcccactccctgttctgcccccgcctcccgggcgtgctgattggctgc
gagtcggccgcgtgttggccagcgcccccctttcagccgaggagccacgcgcggcggcag
aagcaggagcctgagattgggaagggcgccggcgcgaggcgagagcgtcagtgcggcgga
gtggcgggcgtcgcgggggtcgccttggaaacgggccggggccgcgcggacgggcgcctc
gccatggcggcgggcgtgggggcccagggtggcgccatgggcccgctggtgggggccatc
gaccaagggaccagctccacccgcttcttggtttttaatgcaaatacatctgaattgctg
agtcaccatcaagtagagatccagcagaaattccccaaagaagggtgggtagaacaggat
ccagtggaaatacttcagtctgtttatgaatgtgtggaaaggacgtgtgaaaaactgaac
cagctaaatgtagacattgccaatataaaagctgttggagtcagcaatcaaagagagaca
actgtggtgtgggacaaactaactggagagcctctccatgatgctattgtatggcttgac
cttaggacccagcctacagttgagagactgcttaaacgaattccagggcaaaataagtcc
ttcttaaagagtaaaactggtctcccacttagcacatacttcagtgcagtgaaacttcgt
tggcttctagataatgtgccaaaagtcaagcaagcagttttgaaccggagagctttgttt
ggtactattgattcatggctgatatggagtttgacaggtgggaaagatggaggtatccac
tgtactgatgtgaccaatgccagtcgaacaatgctgtttaacattcactcattagaatgg
gatgaggaactttgcaagttttttgaaattcctatggaaatacttcccaaagtgcggagt
tcctcagagatttatggattgatgagttctggagctttgactggcattccaatttctggg
tgcttaggtgaccagtctgctgctctagtaggacaaatgtgctttaaggatggtcaagca
aaaaatacgtatggaacaggctgcttcttactctgcaatacaggtcaaaagcctgcactt
tctgagcatggccttctgacaactgtggcttacaaactgggcagagagaaaccagtgtat
tatgcattagaaggatctgttgccatagctggtgctgttgttcgttggttaagggacaac
ctaggtattgcacggtcttcagatgaaatcgagaaacttgctgctgatgtaggcacttct
tatggctgctactttgtcccagcattctcaggattatatgctccatattgggaacctagt
gctagaggcattatctgtggccttactcagtttacaaataaaaatcacattgcctttgct
gctctagaagctgtttgctttcaaacacgagagattttggatgcaatgaacaaagactgt
ggaattccactaagtcagttacaagttgatggaggaatgactaacaacaagatccttatg
caactccaagctgacattctctgtattccagtagtaaagccatctatgcctgaaactaca
gccctaggagcagctatggcagcaggagcagctgaaggagtaggagtctggagtctcaat
cttgatgatcttacagcagtaacatgtgaatgctttgagccaaagattaatcctgaagaa
agcgagtatcgctacagaaggtggaagaaagctgtaaagaagtcaatgggctgggagaca
tcagaacctcaagaaagtggtgaaactagtatcttctgtagtctacctttgggctttttt
gtaatgagtagcctgttaatgttaatcggagcaaagtacatctcagcttactgtaaatga

DBGET integrated database retrieval system