KEGG   Anolis carolinensis (green anole): 100558319Help
Entry
100558319         CDS       T01608                                 

Gene name
pdia5
Definition
(RefSeq) protein disulfide isomerase family A member 5
  KO
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100558319 (pdia5)
Chaperones and folding catalysts [BR:acs03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100558319 (pdia5)
Membrane trafficking [BR:acs04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100558319 (pdia5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 529 aa AA seqDB search
KKIIYFKLNYSSNISILKLFVLQTIFPACLLSTKISPLIEKISDQKDFKKLLRTRNNVLV
LYSKSSAAADSSLRLLSDVAQAVKGRGTISWIDCGDSESRKLCKKMKVDPSSKEKGVELL
HYKDGTFHTEYTRAPTFKSMVAFLKDPEGAPLWEEDPDAKDIVHIDSEKELKRLLKKEDK
PVLLMFYAPWCGVCKRMMPSFQQASTELKGKYVFAGMNVYSAEFEKIKEEYNVRGYPTIC
YFEKGKFLFNFENYSATAKDIAEWLQNPQPPKPQAPETPWPEEDNAVYHLTDDDFDKFIK
EHSSVLVMFYAPWCGHCKKMKPEYENAAEMLHADSERPGVLAAVDATVNKAVAEKFHISG
FPTLKYFQDGEEKYTLPHLRTKSKIVEWLQNPQAPPPPEPTWEERQTSVTHLAGEDFRES
LKKKKHALVMFYAPWCPHCKNSIPHFTTAAELFKEDRKIAYAAVDCAKEQNHDLCKQEGV
DGYPTFNYYNYGKFIEKYNGDRGESGFTTFMRTLRERDHERIGKRKDEL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
aaaaaaataatttatttcaaacttaattacagtagtaatatttccattttgaaattgttt
gttttgcagactatctttccagcatgcctgttatcaacaaagatatcacctttaatagaa
aaaatcagtgatcagaaggacttcaagaaactcctgaggacgcggaataacgtattggtg
ctatactctaaatcttcggcagctgctgacagttcactcaggttattgtctgatgtagcc
caagcagtgaaaggccgaggtactatatcctggatagattgcggtgattcagagagccga
aaactatgcaagaaaatgaaagtcgaccctagttcaaaggaaaaaggagtagaattacta
cattacaaggatggcacatttcatactgaatacactagagcacccacgttcaagtcaatg
gtggccttcctaaaggatccagaaggagctccattgtgggaggaggatcctgacgccaaa
gatattgtccatattgacagtgaaaaggaacttaagaggcttttgaagaaagaagataag
cctgtgcttctgatgttttatgccccttggtgtggggtttgcaaaagaatgatgccatca
ttccagcaagcatctacagaactgaagggcaagtatgtatttgcaggaatgaatgtctac
tcggctgaatttgaaaaaattaaagaagaatataacgtccggggatacccaaccatctgc
tattttgaaaaaggaaaattcctgtttaactttgaaaactacagtgccacagcaaaggac
atagcagaatggttacaaaatcctcagccacctaaaccacaggcccctgagactccttgg
ccagaagaggataacgcggtttatcacctaacagatgatgactttgacaagtttatcaag
gagcattcttccgtcttagtgatgttctacgcaccatggtgtgggcactgcaagaaaatg
aagccagaatatgagaacgctgctgagatgctccatgcagacagtgagagaccaggtgtt
ctggcagctgtagatgctactgtcaacaaagctgtagcagaaaaatttcacatatcagga
tttccaacattaaaatatttccaagatggagaggagaaatatactctgccacacttgcga
acaaagagtaaaattgttgaatggcttcaaaatcctcaggcaccacctccacctgaacca
acctgggaagaacggcaaacaagtgttacccatctcgcaggtgaagactttagggaatct
ttgaagaaaaagaagcatgcacttgtgatgttctatgccccatggtgcccgcactgtaaa
aactccatcccacatttcacaacagctgcagaactatttaaagaagatcgaaagattgcc
tacgctgcagtggactgcgccaaagaacagaatcatgacctgtgtaagcaggaaggtgtg
gatggttacccgaccttcaactactacaactatgggaaatttatagaaaaatataatgga
gacagaggggaatctggatttacaaccttcatgcgaaccctcagagaacgagaccatgaa
aggatagggaaaaggaaagacgagttgtaa

DBGET integrated database retrieval system