KEGG   Anolis carolinensis (green anole): 100558428Help
Entry
100558428         CDS       T01608                                 

Gene name
whsc1l1
Definition
Wolf-Hirschhorn syndrome candidate 1-like 1
Orthology
K11425  
histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100558428 (whsc1l1)
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100558428 (whsc1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1437 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANNRQEDAFDASSDITEDGRQTPYEAALSLQQGFQ
YPTPTTEDLPPLINGFPPISMYEPQAKYQSYSQYPNGSANGFGSVRNFSPPEYYQMENSN
LRPHEILEKQSPPQPPPPSVSQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNE
VQASEYAKPKHEGRKEKRKKSNKHDASHSEERKSHKIPKLEPEEQNRPNERISNQSERPR
EEPIVLDETPVQEASPSPPTPVVSDVTFEVGDLVWSKVGTYPWWPCMVSRDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGRKQYDQLVAEATKQANHSEKQKIRKPRP
QRERAQWDIGIAHAEKALKMSREERIEQYTFIYVDKEPEEALTKTRRTVVPKMEARKNRR
SKPSPSPQPEPASEASPASSPSNTEVRRHSQRRQSSVEEEPPPVKIAWKTAAARKSLPAS
ITMHQGTLDLQKCNMSPVVKIEQVFALQNAAGNGKFIDQFVYSTKGLGSKPEIIIKGHDK
LTSVSSQRNERASSQRSPSPETSSGLASSVEKKQQRRSIRTRSESEKSTEVVPKKKIKKE
QVETAPQTALKTGLQKGASEISDSCKPLKKRSRASTDVELTSSAYRDTSDSDSRGLNDLQ
GSFGKQSDSPSAAADADASDVQSVDSSLSRRGSGTSKKDSICQICESSGESLLSCEGECY
RVFHTECLGLSSQPEGKFICIECKNGQHTCFSCKLPGKDVKRCSVNACGKFYHEACVRKF
ATTVFESRGFRCPQHCCTSCSVDKDIHKASKGRMVRCLRCPIAYHSGDGCIAAGSLFVSS
HILICSNHSKRSNHSSSAVNVGFCFVCARGLIVQDHSDPLFSSYANKSHYLLNESNRAEL
MKLPMIPPSSSASKKKCEKGGKLLCCESCPASFHPECLHIEMPNGSWNCNDCKAGKKLRY
KQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDIGDFPVFFFGSHDYYWVHQGRVFPYV
EGDKSFAEGQTNINKTFKKALEEAAKRFQELKAQRESKEALEIERNSRKPPPYKHIKSNK
VVGKVQIQVADLSEIPRCNCKPSDENPCGLESECLNRMLQYECHPQVCPAGEGCQNQCFT
KRLYPEAEIIKTDRRGWGLRTKRNIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFY
MLTVTKDRIIDAGPKGNYSRFMNHSCHPNCETQKWTVNGDVRVGLFAVCDIPAGMELTFN
YNLDCLGNGRTECHCGADNCSGFLGVRPKTACATANEEKAKNAKLKQKKRKIKTEQKQMH
EDNCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPFGKWECPWHQCEICGNPATSFCEF
CPHAYCKEHEKGALVASALEGRPCCSEHNPKAPVAPEYWCKIKRRLEQQNPEEEAKE
NT seq 4314 nt NT seq  +upstreamnt  +downstreamnt
atggatttctccttctctttcatgcaagggatcatgggaaacacaattcagcaaccacct
caactcattgactcggctaacaaccgccaggaggatgcttttgatgccagcagcgacatc
acggaagatggcaggcagacaccctatgaagcagcgctctccttgcagcaaggctttcag
tatcccacgccaaccacggaggacctcccacccctcattaacggattcccaccaatcagc
atgtacgaaccccaagccaaatatcagtcctacagtcagtatcccaatggctcggctaac
ggctttggctcagttagaaactttagtccacctgagtattatcaaatggagaactctaac
ttaagaccgcatgagatcctggaaaagcagtctcctccccagcctccacctccttcggta
tcccaaacggtgatcccaaagaagactggttccccagaaatcaaattaaaaataaccaaa
actattcagaacggcagggaattgtttgagtcctctctgtgcggggaccttttaaatgaa
gtacaagcgagtgagtatgcgaagccgaaacatgaagggaggaaagagaaaaggaaaaaa
agtaacaaacacgatgcctcccactcagaagagcgcaaatcacataaaattccaaaacta
gagccagaggaacaaaatagaccaaatgaaagaattagcaaccaatctgaaagaccaagg
gaagaaccaatagtgttggatgaaactccggtacaggaagcctccccttctcccccaaca
ccagtcgtgagcgatgtcacgtttgaggtgggagatcttgtctggtccaaagtggggaca
tatccatggtggccctgtatggtttcaagagacccacaactcgaggttcataccaaaatc
aacacaagaggtgcgcgagaatatcatgttcagttcttcagcaaccagcctgaaagggcc
tgggtacatgaaaagagggtacgggagtacaaaggacgcaaacagtatgatcagttagtg
gcagaggctactaagcaagccaaccattctgaaaaacaaaagatccggaaaccaaggccg
cagagagagcgggcgcagtgggatattggcattgcccatgctgagaaagctttgaaaatg
agccgggaggagaggatagaacagtacaccttcatctatgtagataaagagcccgaggaa
gctttgacaaaaaccaggaggactgttgtgccaaagatggaggctagaaagaatcggcgc
tctaaaccatcgcctagtccccagccagaaccagccagcgaggcttcgccagcatcctct
ccatccaatactgaggtgcggaggcatagtcagagacggcaatccagtgtggaagaagag
ccgcctccggtgaaaatagcatggaagactgctgcagccaggaaatccttaccggcatca
attaccatgcaccagggcaccttggaccttcagaaatgtaatatgtctccagttgttaaa
attgaacaagtttttgctcttcagaatgctgctgggaatggaaagttcattgatcagttt
gtttactcgaccaagggtttaggaagcaaaccagaaataataatcaaggggcatgacaaa
cttacttctgtctcaagccagagaaatgagagagcctcttcgcagaggtcgccttctccg
gagacatcttctgggttggcaagttctgtagaaaagaagcaacagcgaagatcaatacga
actcgctcagagtctgagaaatccactgaagttgtgccaaagaagaagatcaaaaaggag
caggtagaaacagccccacagacagcactgaagacgggattacagaaaggtgccagtgag
atttcagattcttgtaagcctttaaagaaaaggagccgtgcctcaacagatgtggaactg
actagttcggcatacagagatacatctgattctgattcaagagggctgaatgacctacag
ggtagctttggaaagcagtcggacagtccgtcagctgcggcagatgcagatgcttctgat
gtacagtctgtggactcaagtttatcaagaagaggttctgggacaagtaagaaagacagc
atttgtcagatttgcgaaagttctggcgaatccctcctatcttgtgaaggcgagtgctac
cgagtcttccataccgaatgcttaggcctgagctcacagcctgaggggaagttcatctgt
atagagtgcaaaaacgggcagcacacatgcttttcctgcaagctccctggtaaagacgtg
aagcgttgctctgtcaatgcctgtggcaaattctaccatgaagcctgtgtgcgcaagttc
gccaccactgtctttgagtcccggggattccgttgcccacagcactgctgtacttcctgc
tctgtagacaaggatattcataaagcaagcaaaggtcgcatggtgagatgtttgaggtgc
cccattgcctatcactcgggagatggctgtattgctgcgggaagtttgtttgtgtcatcc
cacattctcatctgtagtaaccattccaaaaggagcaatcactcttcatcagctgtaaat
gtaggcttttgtttcgtttgtgcaagagggctgatagtgcaggatcattcagaccccctg
ttcagttcatatgccaataagtcccactacctactgaatgaatcaaatcgtgctgagttg
atgaaattacctatgattcctccttcttcgtcagcttccaaaaagaaatgtgagaaaggt
gggaaactgttgtgctgcgaatcctgccctgcatccttccacccggaatgtcttcacata
gagatgccaaatggctcctggaattgcaatgactgtaaagctggcaagaagctgcgatac
aagcagattgtgtgggtcaagcttggaaattacaggtggtggccagctgagatctgcaac
cccaggtctgttcctctcaacatccagggcctcaagcatgatatcggggacttcccagta
tttttctttggttcacatgactactattgggtacatcagggcagagtctttccttatgtt
gaaggagacaaaagctttgcagaagggcaaactaacattaacaagaccttcaagaaagca
cttgaagaagcagcaaaacgcttccaggaactcaaagcacaaagagaaagcaaagaagca
cttgagattgagcggaattccagaaagccaccgccctataaacatattaaatccaataaa
gtagtagggaaggttcagattcaagttgcagacttatcggaaatccctcggtgcaactgt
aagccgtcggatgagaacccctgcgggctggagtccgaatgcctcaaccggatgctccaa
tacgagtgccaccctcaggtttgccccgcaggagagggttgccagaaccagtgttttacc
aaaagactctatccagaggcagaaattataaagacggaccgacgcggctggggtcttagg
acaaagcggaatattaaaaagggtgaatttgtcaatgagtatgtgggtgaattgattgac
gaggaagaatgtcggttgcggatcaaacgggcccatgagaacagcgtgacaaatttttat
atgttaactgttacaaaggaccgcataatagatgctggcccaaaggggaattactctcgc
tttatgaaccacagctgccaccccaactgtgaaacccagaagtggacggtgaatggggat
gtccgagttgggctttttgctgtgtgtgatattcctgcagggatggagttaacatttaac
tataatctggattgcctggggaatggcaggactgaatgccattgtggagcagataactgc
agtggattcctaggagtgcggccaaagacggcatgtgcaactgcaaacgaagagaaggcg
aaaaatgcaaaattgaagcagaagaagaggaagataaagacagagcagaagcagatgcat
gaggacaactgtttccagtgtggagatgggggtgaattggtcatgtgtgacaaaaaagac
tgtcccaaagcgtaccacctcctctgccttaacctgacgcagccaccattcggaaaatgg
gagtgtccgtggcaccagtgtgagatctgtggcaacccggccacttcattctgcgagttc
tgccctcacgcttattgcaaagagcatgaaaagggagccctcgtggcctcggccttggag
ggccgcccatgctgctccgaacacaaccctaaggcccctgtggcgccagaatactggtgc
aagatcaagcgccggttggaacaacagaatcccgaggaagaggcgaaggaatga

DBGET integrated database retrieval system