KEGG   Anolis carolinensis (green anole): 100558466Help
Entry
100558466         CDS       T01608                                 

Gene name
ehhadh
Definition
(RefSeq) enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
  KO
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100558466 (ehhadh)
   01212 Fatty acid metabolism
    100558466 (ehhadh)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100558466 (ehhadh)
   00650 Butanoate metabolism
    100558466 (ehhadh)
  Lipid metabolism
   00071 Fatty acid degradation
    100558466 (ehhadh)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100558466 (ehhadh)
   00310 Lysine degradation
    100558466 (ehhadh)
   00380 Tryptophan metabolism
    100558466 (ehhadh)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100558466 (ehhadh)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100558466 (ehhadh)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100558466 (ehhadh)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100558466 (ehhadh)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100558466 (ehhadh)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     100558466 (ehhadh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 722 aa AA seqDB search
MAQVLRGVRVIRVCNPPLNTLSPVVTQALERDVNQANSDPTVKAVVICGANGKFSAGADI
RNFANIGQSKFSSLESVVSLIEKSDKPMVAAIEDLAFGGGLEIALGCHYRIANMKARVGL
PEVTIGLLPGAGGTQRLPRLIGVPAAIDIITTGRHVPATEALKLGILDEVVEENPIEAAI
NLAQRVTGQPLGPRRLCLKEVPKLPNMEAFLDEARLKVKKRANGQLSPQMCFEAVRASVY
LPFAEGIQKEKQLFMYLLSSGQSKALQYAFFAQRAMEKWVLPNGASWGTADPQPVKKAAV
IGLGTMGRGIVASLLKAKIPVVALEQDKKQLEVGKAAVMALLEREALKMHQNGQKPKKPI
VPHFTLDFGALKDVDLVIEAVFEEIALKKEIFHKLSVICKPEALLGTNTSYLDIDEIASV
TDRPHKVIGIHFFSPAHIMKLVEIIYGQQTSPSAIATAMSLAKSMGKIGVVVGNCFGFVG
NRMLTHYYDQAYFLIEDGSTPEEVDKVLQEFGFKMGPLRVGDLAGLDVGWRIRKGKGQTG
DALPPGTPPRHRDGMRYSPIPDMLCEMGRYGEKTGKGWYLYDKPGGKIAQPDPWLHGFLS
DFRRTHNITARTISQDEILERCLYSLANEGFRILSDGIASCPEAIDTIYINGYAWPRHTG
GPMFYTSQVGLPKVLAKLQEYAEANPDIPSLQPSPFLQKLVALGSPPLKEWASHVRSQNS
KL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggtcctgcgaggcgtgcgcgtgatcagggtctgcaacccgcccctcaacact
ctcagccctgttgtaacacaggctttagaacgtgatgtgaaccaggcaaattccgatccc
acagtgaaagctgttgtgatatgcggggcaaatggcaaattcagtgcaggtgccgatatc
agaaattttgccaacattggccagagcaaattctccagtctcgagtcagttgtttcttta
atagagaaaagcgacaagccaatggtagctgctattgaggacttggctttcggaggaggc
ctggagatagcactgggctgtcattacaggattgctaatatgaaggctcgggtaggttta
cctgaggtaacaataggtttactccctggtgctggtgggactcaacggcttcctagactg
attggagtaccagctgcaatcgatatcatcactacaggaagacatgtgccagctactgaa
gcactgaaactggggatcctcgatgaggttgtggaagaaaacccaattgaagctgccata
aacttggcacaaagagtaacaggtcagccattgggacctcgcaggctctgcctgaaagaa
gtacccaaactacccaacatggaagccttccttgatgaggctcgcctgaaagtcaagaaa
agggcaaatggacagctctcgccacaaatgtgttttgaagctgtacgagcttctgtgtac
ctgccctttgcagaaggaattcagaaagagaaacagctctttatgtacctcttgagttcg
ggacagtctaaggcattgcagtatgccttttttgcacagcgagccatggagaagtgggtg
ttgcccaacggagcttcatggggaactgcagaccctcagccagtgaaaaaagcagctgtg
ataggattgggaacgatgggccgaggcatcgtggcttctctgctgaaggctaaaattcct
gtggtggctctagagcaggacaaaaagcagctggaggtgggaaaggcagccgttatggct
ctgttagaacgtgaagctttaaaaatgcaccagaatggccaaaaaccaaagaagcctata
gtccctcattttactctggattttggtgccctgaaggatgtagatttagttattgaggct
gtgtttgaggagatagctctcaagaaggaaatattccataaattgtcagtaatctgcaaa
cctgaagcccttcttgggactaatacttcctacctagatattgatgagattgcttctgtc
acggatcgccctcataaagtcattggcatccatttcttctcaccggctcacattatgaaa
ctagtggagatcatctatggtcagcagacatccccttctgccattgctactgccatgagc
ctagccaaatctatgggtaaaattggagttgtagtagggaattgttttggttttgttggc
aaccgaatgttaacccattactatgaccaagcgtattttctcatagaagatggcagcact
ccagaagaagtagacaaagttctgcaggaatttggtttcaaaatgggccccttacgggtg
ggagatctggctggacttgatgtgggctggagaattaggaaagggaaaggccagactgga
gacgctctgcctcctgggacaccacctcgccatcgggatggcatgcgatatagtccaatc
cctgatatgctgtgcgaaatgggaagatatggtgaaaaaacaggaaagggctggtaccta
tatgataaacctggaggaaagatagctcaaccagatccttggctgcatggttttctttct
gattttagacgtactcataacatcacagcacgcactatcagccaagatgagattttagag
cgttgcctatattcccttgccaatgaaggtttccgaatattatctgatggaatagcatct
tgtccagaagccattgataccatctatatcaatggctatgcctggcctagacatacgggc
ggtccaatgttttatacttctcaggttgggttgcccaaggttttagcaaaactgcaggag
tatgctgaggctaatcctgacatacccagcctgcaacccagcccttttctgcaaaagctt
gtagctttgggcagccctcctctgaaagagtgggcatcccatgtcagatctcaaaacagc
aagttatga

DBGET integrated database retrieval system