KEGG   Anolis carolinensis (green anole): 100558507Help
Entry
100558507         CDS       T01608                                 

Gene name
ppox
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00860  Porphyrin and chlorophyll metabolism
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100558507 (ppox)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100558507 (ppox)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     100558507 (ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like Thi4 Pyr_redox_2 NAD_binding_9 MCRA FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 100558507
NCBI-ProteinID: XP_003229083
Ensembl: ENSACAG00000004038
Position
Un
AA seq 476 aa AA seqDB search
MPRTVAVLGGGVSGLSACFYLSRSPQAPKVILLESSSRLGGWISSTRTEDGAVFEHGPRG
VRPAGNVGKNTLLMVSELGLESDLLPVPGDHPASKNRYLYLQGALHKLPSSIGGIVRTVP
PFTRPLLWSGLKELVAPRGSEPDETIHAFVKRRFGQELADIVIDSLCRGVFAGDCRALSV
RSCFPALFQAERAHRSVILGMTLAGGKGAPALDSPLIRRAKEERWSQWSLRGGMQTLPEA
LEAFLKQRGAEIHRDTPVKRMERTASGSWRIMLDDGSIEADHVISALPAKALAASLPAWA
EPLSRELLNIRAVSVAVVNLAYGNVGLPVMGFGHLVPSFEDNALLGIVYDSVAFPEQDGS
GGPAIRLTVMLGGAWFKLGLGDPDTVSHAMLLSCAKAAVKKHLGIHAEPSRAIVKVQKAC
IPQYEIGHWKHIENAATYLVQQKLPLSLIGASYEGVSVNDCISGARAAAVKLLGQT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggactgtggccgtccttggcggaggggtcagtggcttgtccgcctgcttctac
ctctcccggagcccccaggcgcccaaggtcatccttctcgaaagcagcagccgcttggga
ggctggatcagctccacgcggacagaggacggagctgttttcgaacacggaccccgaggg
gtccgtcccgccgggaatgtgggcaagaataccctccttatggtctccgaacttggactc
gaaagcgacctccttcccgtcccgggcgaccacccggcctccaaaaaccgctacttgtat
ctccaaggggctttgcataaactcccctcaagcatcggcggcattgtccggacggtgcct
ccgttcacccgtcctctgctctggagcggactcaaggaactggtggcgcctcgaggatcc
gaacccgacgagaccatccatgcctttgtcaagcgccgcttcggccaggagctggcggac
atcgtgattgacagcctctgccgcggggtgtttgcgggcgactgccgtgcgctgagtgtg
cgctcctgcttcccggctcttttccaggccgagcgggcacaccgatccgtcatcctgggc
atgaccttggctggagggaaaggggctcccgccttggactccccgctgatccgcagggcc
aaggaggagcgctggagccagtggtccctccggggtgggatgcagaccctcccggaagcc
ctggaagccttcctcaagcagcgcggggccgagatccaccgggacacccctgtcaagcgg
atggagaggacggcatccggatcctggaggataatgctggacgacgggagcatcgaggcc
gaccacgtcatcagtgctttgcccgccaaagcactcgcggcatctctccccgcctgggcc
gaaccactttctcgcgagcttctaaacatccgagcggtgtccgtagccgtggtcaacctg
gcgtatggcaacgtggggctccccgtgatgggttttgggcacctggtgccgtcttttgag
gacaatgccttactcggcatcgtttacgactcggtggcatttcccgaacaggacggatcc
ggtgggcctgccattcgcctcacggtgatgctgggcggtgcatggttcaagctgggactt
ggagaccccgacacagtctcccacgcgatgttactgagttgtgccaaagcagccgtcaag
aaacatcttgggatccatgccgagccttctcgggccatcgtcaaggtgcagaaggcgtgc
atcccgcagtatgaaatcggtcactggaagcacatagagaatgcagccacttacctggtg
cagcagaaactacctctgagtctgatcggggcttcctatgaaggcgtctccgtcaacgac
tgcatctctggtgctcgggcagcagcggtcaagctcctcggccagacttga

DBGET integrated database retrieval system