KEGG   Anolis carolinensis (green anole): 100558535Help
Entry
100558535         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100558535
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100558535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 495 aa AA seqDB search
MPLFTVNVKWGKEKFDGVELNTDEPPMVFKAQLFALTGVQPDRQKVMVKGGTVKDDDWGN
IKIKNGMTLLMMGSAEALPEEPVARPVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKEALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGDQGQYLQQDANECWVQMMRVLQQKLEGIEGDTVMETDPGASGAAAAPPKK
KSLIDQFFSIEFETTMKCTEAEEEEVTKGRENQLQLSCFINQEVKYLFTGLKLRLQEEIT
KLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELC
TPELQESMVPYRSKFKDLEDKKVNQQTKNSSKGDGAQKEVKYEAFSFPDDIGSNNCGYYE
LQAVLTHQGRSSSSGHYVSWVKRKEDEWIKFDDDKVSTVTPEDILRLSGGGDWHIAYVLL
YGPRRIEVMEEEAEQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttttcacagttaatgtaaaatggggtaaagagaaattcgatggagtggagctg
aatacggatgagcctccaatggtattcaaagctcagctttttgctttgactggagttcag
cctgacagacagaaagtaatggtgaaaggtggaactgtaaaggatgatgactggggaaac
atcaaaattaaaaatgggatgaccttattaatgatgggttccgctgaagcgcttcctgaa
gaaccagtagccaggcctgtttttgttgaagatatgacagaggaacagttggcttcagct
atggagttaccgtgtggcttaacaaatcttgggaatacttgttatatgaatgctacagtt
cagtgtattcgttctgtgccagaactgaaagaagcccttaagaggtatgctggtgcctta
agagcttcaggggaaatggcctctgctcagtatattactgcagctcttagagatttattt
gattccatggataaaacctcctctagtatccctcccatcattctcctccagtttttacat
atggcctttcctcagtttgcggagaaaggcgatcaaggccagtatcttcaacaggatgcc
aatgaatgttgggtacagatgatgcgagtactgcagcagaagttagaagggatagaaggt
gatacagttatggaaaccgaccctggagcttcaggagcagctgctgcacctcctaaaaag
aagagcttaattgatcaatttttcagtattgaatttgaaactaccatgaaatgtacagaa
gcagaagaagaggaagtcacaaaaggaagagagaatcaactccaacttagttgctttatc
aatcaagaagttaaatatcttttcacgggtcttaaactgcgccttcaagaagaaatcacc
aaactgtctccaaccttgcaaagaaatgcgctttacataaaatcttccaaaataagtcgc
ctgcctgcttacctgactattcagatggttcgtttcttttacaaagagaaagaatctgtg
aatgccaaagttctcaaggatgttaaatttcctcttatgttggatgtatatgaattatgt
acaccagaactccaagagagcatggttccctaccgatcaaaattcaaggacttggaagac
aagaaagtaaatcaacaaacaaagaattctagtaaaggtgatggtgcacagaaagaagtt
aaatatgaggcattttcctttcctgatgatattggctccaataactgtggctattacgaa
ctgcaggccgtgttaacacatcaaggaagatctagttcttctggacactatgtatcctgg
gttaaaagaaaagaagacgaatggattaaatttgatgatgacaaagtcagcactgttaca
ccggaagacatcttgaggctatctgggggtggagactggcatatagcttacgtccttctt
tatgggccacgcagaattgaagttatggaagaggaagctgaacaatag

DBGET integrated database retrieval system