KEGG   Anolis carolinensis (green anole): 100558567Help
Entry
100558567         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-A-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100558567
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100558567
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100558567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 525 aa AA seqDB search
MSPPAAGCCHVTGFKVENWKQNLRVIYQCFVWSGSAEARKRKAKSCICHMCGAHLNRLHS
CLYCVFFGCFTKKHIHEHAKAKRHNLAIDLLYGGIYCFMCQDYIYDKDMEQIAKEEQRKA
WKLQAFTPTMVSHYQCTMTGIGEKYSTWEPTKRELELLRHNPKRRKITTNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHKCEMQSPSSCLVCEMSTLFQEFYSGHRSPHI
PYRLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDGSVVNGESHVTGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPADSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagtccgccggccgccgggtgctgccatgtgaccggcttcaaggtggagaactggaag
cagaacctgcgcgtcatctaccagtgcttcgtctggagcgggtccgccgaggccaggaag
aggaaggcaaagtcgtgtatctgtcatatgtgtggtgcacatctgaacagactccattct
tgcctatattgtgtcttctttggctgtttcacaaagaagcacattcacgagcacgcaaag
gcaaagcgacacaacttagccatagaccttttgtatgggggtatatactgctttatgtgt
caagattacatatacgacaaagatatggaacaaattgccaaagaagaacaacgaaaagct
tggaagctacaagccttcaccccaacaatggtttctcactaccagtgtacaatgacaggt
attggagagaagtattcaacatgggagccaaccaaacgagagttagagctgcttcgacac
aaccccaaacggagaaaaataactacaaactgcaccataggtctaagagggctaatcaac
cttgggaacacatgttttatgaactgtattgtccaagcacttacccacactccactactg
cgagatttcttcctctccgacagacacaaatgtgaaatgcaaagtcccagctcatgtctg
gtctgtgaaatgtctacgctttttcaggagttctactccgggcaccgatctcctcacatt
ccatataggttattgcacctggtatggacgcacgcgcggcatttagcagggtacgagcaa
caggatgcgcacgagttcctcatcgctgcgttagatgtgctacatcgacactgcaaaggt
gacgataatgggaagaaagccaacaaccccaaccactgtaactgcatcatagaccaaatc
ttcacaggtggactacagtctgatgtcacttgccaagtctgccacggtgtttccacaacg
atagatccgttctgggacatcagtttggatttgcccggttcctccaccccgttctggcct
ctgagcccaggcagcgacggcagcgtggtcaatggggagagccacgtgacgggaaccacc
accctcacagactgcttgcgaaggtttacaaggccagaacacctaggaagcagtgccaaa
atcaaatgtagtggttgccatagctaccaggaatctaccaaacaactcactatgaagaaa
ttacccattgtggcctgttttcatctcaaacggtttgaacactcagccaaactgaggcga
aagattactacatatgtctcctttccattggagttggacatgacaccatttatggcttcc
agtaaagagagcagaatgaacgggcagtatcagcagccggcagatagtctaaacaacgat
aataagtattccttgtttgcagtagttaatcaccagggaaccctggagagcgggcactat
accagcttcatccggcaacacaaggaccagtggttcaaatgtgacgatgccatcatcacc
aaggctagcattaaggatgtactagacagtgaaggctatttgctgttctatcacaaacag
ttcctggaatacgagtag

DBGET integrated database retrieval system