KEGG   Anolis carolinensis (green anole): 100558590Help
Entry
100558590         CDS       T01608                                 

Gene name
ppp1ca
Definition
(RefSeq) protein phosphatase 1 catalytic subunit alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs03015  mRNA surveillance pathway
acs04114  Oocyte meiosis
acs04218  Cellular senescence
acs04261  Adrenergic signaling in cardiomyocytes
acs04270  Vascular smooth muscle contraction
acs04510  Focal adhesion
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100558590 (ppp1ca)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100558590 (ppp1ca)
   04218 Cellular senescence
    100558590 (ppp1ca)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100558590 (ppp1ca)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100558590 (ppp1ca)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100558590 (ppp1ca)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100558590 (ppp1ca)
   04270 Vascular smooth muscle contraction
    100558590 (ppp1ca)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100558590 (ppp1ca)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100558590 (ppp1ca)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100558590 (ppp1ca)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100558590 (ppp1ca)
Messenger RNA biogenesis [BR:acs03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100558590 (ppp1ca)
Spliceosome [BR:acs03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100558590 (ppp1ca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 100558590
NCBI-ProteinID: XP_003215019
Ensembl: ENSACAG00000008113
UniProt: G1KHF3
Position
1
AA seq 330 aa AA seqDB search
MSDGEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGSEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPVTPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacggcgagaagctcaacctggactccatcatcgggcgcctcttggaagtacaa
ggctcacgcccaggcaagaatgtacagctgacagaaaatgagatccgcggcctatgcctg
aagtcacgggagatcttcttgagccagcccatcttgttggaattggaagccccactcaag
atatgtggtgacatccacggccaatactatgacttgctccgactctttgaatatggaggc
ttcccgccagagagcaactacctctttttgggtgactatgtggaccgagggaagcagtca
ctggagaccatctgcctgctcctggcctacaagattaagtaccctgagaacttcttcctg
ctgcgtggaaaccacgaatgtgccagcatcaaccgcatctatggtttctatgatgaatgt
aaaagacgctataacatcaagctttggaagaccttcacagactgtttcaactgtctgccc
attgctgccattgtggatgagaagattttctgctgccatggaggtctctcgcctgacctc
cagtccatggaacagatccggcggattatgagacccacagacgtacccgaccagggtctg
ctctgtgatctgctctggtctgatcctgataaagatgtacagggctggggcgagaatgac
cgtggggtctcattcacgtttggctcggaggttgtcgccaaatttctccacaaacatgac
ctggacctgatctgtcgagcgcatcaggtcgtagaagatggatatgagttttttgccaaa
aggcagctggtgacacttttttctgccccaaactactgtggcgagtttgacaatgcaggt
gcaatgatgagtgtggacgagactcttatgtgctcctttcagatcttgaaaccagctgac
aagaacaagggcaaatatggccagttcagtggcctgaacccgggagggcgccctgtcact
ccgccacgcaactcggcaaaagccaagaagtaa

DBGET integrated database retrieval system