KEGG   Anolis carolinensis (green anole): 100558633Help
Entry
100558633         CDS       T01608                                 

Gene name
usp8
Definition
ubiquitin carboxyl-terminal hydrolase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100558633 (usp8)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100558633 (usp8)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100558633 (usp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1043 aa AA seqDB search
MIEGVATEFVEPDFKQQQDYFHSLLGPTNVKKAIEEAERLSESLKLRYEEAEVRKKLEER
ERLEEQQLKKQESKDDAKALSKTSSEISSDPKGKNQIVNGERKSSTERKDLPESGAITAE
KLFTMMMDKSIKLMIMDARCLKDYQESCIINSVCVPEEAITPGETANLIEAKLPEASKEA
WKERGQASYVVLLDWFSSVKDLQLGTPLRSLKDALFKWESKAVLQNEPLVLDGGYENWLL
CYPQYTTNAKVIPPQRSKSEAVSVSLDFTYPSLEEPVPPPLPVVHVKPSVVEVTERPETT
NDQERKIEAFKPPVSAGSVAVAFKGDSSSPIVPPVPAMKIIPQVDRTKKPSTKIPDGDDK
PKADSPVINKPLISNGKVVPDRSKKPPLDTKVSLSEEEKIHIPGEKASQLEKNRQEKELQ
EEQKEKLKQTKHDQEPTAKEEQEKEGRETLLNEKEQASRGTGDKQEMDKAPKELTDFKKT
SKVVTETPEVKKNDSEKTKVTWTPEIQRHKFAEESRASVRGDTVSSKQTEIKHQAETQKP
GDIREDTEQESEKNKSQREPLTRARSEEMGRIIPGLPAGWAKFLDPITGTFRYYHSPTNT
VHMYPPEMTPSATPPSTPPTHKPKPRAADQREREHSKLKRSYSSPDITQAIQEEERKKVT
ITPTINRENKPVSYPKAEISRLSASQIRNLNPVFGGMGPALTGLRNLGNTCYMNSILQCL
CNAPHLADYFNRNYYQVDINRSNFLGHKGEVAEEFGIIMKALWAGQYRYISPKDFKMTIG
KINDQFAGYSQQDSQELLLFLMDDLHEDLNKADNRKRYKEENNDDLDDPKAADLAWHKHK
QLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQECFRLFSKEE
KLTDNNRFYCSHCKTRRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLESL
DVSQYVIGPKSNSKRYNLFAVSNHYGGLDGGHYTAYCKNATKQRWYKFDDHEVSEISTSS
VKSSAAYILFYTSLEQRALDTAT
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaggagtagctaccgaattcgtggagcccgatttcaaacaacaacaagattac
tttcattccctacttggacctaccaatgttaaaaaagctatcgaagaggctgaaaggctt
tcagaaagtcttaaacttaggtatgaagaggcagaagtgcggaagaaactggaagaaagg
gaaagattggaagagcaacagctgaaaaaacaagaatcaaaagatgatgcaaaggcttta
tcaaaaacatcttcagaaatttcatcagatcctaaaggaaaaaatcaaatagtcaatggt
gagaggaagagttcaactgaaagaaaagatctgcctgaaagtggagcaatcacggcagag
aaattgtttacaatgatgatggacaaaagcatcaagctgatgataatggatgctcgatgc
ttaaaggattaccaggagtcctgcatcataaactccgtctgtgttccagaagaagctatc
actccaggagaaaccgctaacctgattgaagctaagctcccagaggcttctaaagaggca
tggaaagagagggggcaagccagttatgttgttttgctcgactggtttagttcggtaaag
gatttgcaattgggaacacctttgcgaagcctcaaagatgcgcttttcaagtgggaaagt
aaagctgtgctacagaatgagcccttggtcttagatggaggttatgagaactggcttctt
tgctatccccagtatacgacaaatgccaaagtcattccaccgcaacgcagcaagagcgaa
gcggtttctgtttctctggattttacatatccgtctttggaagaaccagttccccctccg
ctacctgttgttcatgtaaaaccttctgtggtggaagtgacagagagacctgaaaccaca
aatgatcaggaaaggaaaatagaggcatttaaaccaccagtttctgctggctcagttgct
gttgcttttaagggcgacagttcatctcccattgtcccgccagtacctgccatgaagatt
atccctcaggttgatcgtacaaaaaagccttcaacaaaaattccggacggtgatgataag
ccgaaagctgacagcccagttattaataaaccacttatttcaaatgggaaagtggtccca
gaccgctccaagaagccaccattggatacaaaggtcagcctgagcgaagaagagaaaatc
cacatccctggagaaaaagcttctcagctagaaaaaaacaggcaggaaaaagaactgcag
gaagaacagaaagagaagttgaaacagacaaagcacgaccaagaaccaacagctaaagag
gagcaggaaaaggaaggccgagaaactcttttgaacgaaaaagaacaggccagtagagga
acaggggacaagcaagagatggacaaggcaccaaaagaattaacagactttaaaaagaca
agtaaagttgtgactgaaactcctgaagtgaaaaaaaatgacagcgagaaaacaaaggtg
acctggacgccagaaatccagaggcacaaatttgcagaggagtcccgtgcctccgtgcgg
ggcgacactgtctctagcaagcagactgagattaaacaccaagcagaaactcaaaaacca
ggagatattagagaagatactgaacaagagtctgaaaaaaataaatcccaacgggaacca
ttaacaagagcacggagcgaggagatggggagaattataccaggattgcctgctggctgg
gctaaatttcttgatccaattaccgggacattccgttactaccactctccgaccaacact
gttcatatgtatcctccggaaatgaccccgtcggccactccaccttctactcctccgact
cataaacccaaacctcgggctgcggatcagcgggagagagagcactccaaactgaagcgc
tcatactcctctccagacataacccaggccatccaggaggaggagagaaagaaagtcacc
atcacccccaccatcaatcgcgaaaataaaccagtaagctatcctaaagctgaaatctca
aggctttctgcatctcagattcgtaatctcaaccctgtatttgggggaatgggaccagcg
ctcacaggccttcgaaatttaggaaatacttgctatatgaactccatcttacaatgcctg
tgtaatgccccacatctagcggattacttcaacagaaattattatcaagttgatatcaac
aggtcaaatttcctggggcacaaaggtgaggtggcagaggagtttggcatcatcatgaaa
gccctctgggctggacagtaccgatatatcagtcccaaagacttcaagatgaccattggg
aagatcaatgaccaatttgcagggtacagtcagcaggactctcaagagctgctcttgttt
ttaatggatgacctccatgaagacttgaataaagccgacaacagaaagcgttacaaagag
gaaaacaatgatgacctggatgaccccaaagcggccgacttggcctggcacaagcacaag
cagctcaacgagtccattattgtggcactcttccaagggcagttcaagtccacagtgcag
tgcctgacctgccataaaaagtctcggacctttgaggcctttatgtatttgtccttgccg
cttgcgtccactagcaaatgcacgttgcaggagtgctttagattgttctccaaagaagaa
aaactgacagataacaatagattttactgtagtcattgcaaaacccgaagagactctttg
aaaaaaatagagatctggaagctgcctcctgtgcttttagttcatttgaaaaggttttct
tacgatggacgatggaagcaaaagcttcagacatcggttgatttccccttggaaagtctt
gacgtgtcgcaatacgttattggcccaaagagtaactcaaagagatacaacctgtttgcc
gtatctaaccattatggagggctggacggagggcactataccgcctattgcaaaaacgct
accaaacagcgctggtataagtttgacgaccacgaagtctcggagatctccacttcctcc
gtgaaatcttcagccgcctatatcctcttttacacatctcttgaacagcgagcccttgat
acagctacataa

DBGET integrated database retrieval system