KEGG   Anolis carolinensis (green anole): 100558633Help
Entry
100558633         CDS       T01608                                 

Gene name
usp8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:acs04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1066 aa AA seqDB search
MPAVASVPKDLYLCTSLKDLNKKTEIKPEKTSTKSYVQSALKIFKPDFKQQQDYFHSLLG
PTNVKKAIEEAERLSESLKLRYEEAEVRKKLEERERLEEQQLKKQESKDDAKALSKTSSE
ISSDPKGKNQIHYSFSQGAITAEKLFTMMMDKSIKLMIMDARCLKDYQESCIINSVCVPE
EAITPGETANLIEAKLPEASKEAWKERGQASYVVLLDWFSSVKDLQLGTPLRSLKDALFK
WESKAVLQNEPLVLDGGYENWLLCYPQYTTNAKVIPPQRSKSEAVSVSLDFTYPSLEEPV
PPPLPVVHVKPSVVEVTERPETTNDQERKIEAFKPPVSAGSVAVAFKGDSSSPIVPPVPA
MKIIPQVDRTKKPSTKIPDGDDKPKADSPVINKPLISNGKVVPDRSKKPPLDTKVSLSEE
EKIHIPGEKASQLEKNRQEKELQEEQKEKLKQTKHDQEPTAKEEQEKEGRETLLNEKEQA
SRGTGDKQEMDKAPKELTDFKKTSKVVTETPEVKKNDSEKTKVTWTPEIQRHKFAEESRA
SVRGDTVSSKQTEIKHQAETQKPGDIREDTEQESEKNKSQREPLTRARSEEMGRIIPGLP
AGWAKFLDPITGTFRYYHSPTNTVHMYPPEMTPSATPPSTPPTHKPKPRAADQREREHSK
LKRSYSSPDITQAIQEEERKKVTITPTINRENKPVSYPKAEISRLSASQIRNLNPVFGGM
GPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNYYQVDINRSNFLGHKGEVAEEFGI
IMKALWAGQYRYISPKDFKMTIGKINDQFAGYSQQDSQELLLFLMDDLHEDLNKADNRKR
YKEENNDDLDDPKAADLAWHKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYL
SLPLASTSKCTLQECFRLFSKEEKLTDNNRFYCSHCKTRRDSLKKIEIWKLPPVLLVHLK
RFSYDGRWKQKLQTSVDFPLESLDVSQYVIGPKSNSKRYNLFAVSNHYGGLDGGHYTAYC
KNATKQRWYKFDDHEVSEISTSSVKSSAAYILFYTSLEQRALDTAT
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcatctgtacctaaagacctatatctgtgcacttcattgaaagatctt
aacaaaaagacagaaataaaacctgagaaaaccagtactaagagttatgtacagagtgct
cttaagatcttcaaacccgatttcaaacaacaacaagattactttcattccctacttgga
cctaccaatgttaaaaaagctatcgaagaggctgaaaggctttcagaaagtcttaaactt
aggtatgaagaggcagaagtgcggaagaaactggaagaaagggaaagattggaagagcaa
cagctgaaaaaacaagaatcaaaagatgatgcaaaggctttatcaaaaacatcttcagaa
atttcatcagatcctaaaggaaaaaatcaaatacactattccttctctcaaggagcaatc
acggcagagaaattgtttacaatgatgatggacaaaagcatcaagctgatgataatggat
gctcgatgcttaaaggattaccaggagtcctgcatcataaactccgtctgtgttccagaa
gaagctatcactccaggagaaaccgctaacctgattgaagctaagctcccagaggcttct
aaagaggcatggaaagagagggggcaagccagttatgttgttttgctcgactggtttagt
tcggtaaaggatttgcaattgggaacacctttgcgaagcctcaaagatgcgcttttcaag
tgggaaagtaaagctgtgctacagaatgagcccttggtcttagatggaggttatgagaac
tggcttctttgctatccccagtatacgacaaatgccaaagtcattccaccgcaacgcagc
aagagcgaagcggtttctgtttctctggattttacatatccgtctttggaagaaccagtt
ccccctccgctacctgttgttcatgtaaaaccttctgtggtggaagtgacagagagacct
gaaaccacaaatgatcaggaaaggaaaatagaggcatttaaaccaccagtttctgctggc
tcagttgctgttgcttttaagggcgacagttcatctcccattgtcccgccagtacctgcc
atgaagattatccctcaggttgatcgtacaaaaaagccttcaacaaaaattccggacggt
gatgataagccgaaagctgacagcccagttattaataaaccacttatttcaaatgggaaa
gtggtcccagaccgctccaagaagccaccattggatacaaaggtcagcctgagcgaagaa
gagaaaatccacatccctggagaaaaagcttctcagctagaaaaaaacaggcaggaaaaa
gaactgcaggaagaacagaaagagaagttgaaacagacaaagcacgaccaagaaccaaca
gctaaagaggagcaggaaaaggaaggccgagaaactcttttgaacgaaaaagaacaggcc
agtagaggaacaggggacaagcaagagatggacaaggcaccaaaagaattaacagacttt
aaaaagacaagtaaagttgtgactgaaactcctgaagtgaaaaaaaatgacagcgagaaa
acaaaggtgacctggacgccagaaatccagaggcacaaatttgcagaggagtcccgtgcc
tccgtgcggggcgacactgtctctagcaagcagactgagattaaacaccaagcagaaact
caaaaaccaggagatattagagaagatactgaacaagagtctgaaaaaaataaatcccaa
cgggaaccattaacaagagcacggagcgaggagatggggagaattataccaggattgcct
gctggctgggctaaatttcttgatccaattaccgggacattccgttactaccactctccg
accaacactgttcatatgtatcctccggaaatgaccccgtcggccactccaccttctact
cctccgactcataaacccaaacctcgggctgcggatcagcgggagagagagcactccaaa
ctgaagcgctcatactcctctccagacataacccaggccatccaggaggaggagagaaag
aaagtcaccatcacccccaccatcaatcgcgaaaataaaccagtaagctatcctaaagct
gaaatctcaaggctttctgcatctcagattcgtaatctcaaccctgtatttgggggaatg
ggaccagcgctcacaggccttcgaaatttaggaaatacttgctatatgaactccatctta
caatgcctgtgtaatgccccacatctagcggattacttcaacagaaattattatcaagtt
gatatcaacaggtcaaatttcctggggcacaaaggtgaggtggcagaggagtttggcatc
atcatgaaagccctctgggctggacagtaccgatatatcagtcccaaagacttcaagatg
accattgggaagatcaatgaccaatttgcagggtacagtcagcaggactctcaagagctg
ctcttgtttttaatggatgacctccatgaagacttgaataaagccgacaacagaaagcgt
tacaaagaggaaaacaatgatgacctggatgaccccaaagcggccgacttggcctggcac
aagcacaagcagctcaacgagtccattattgtggcactcttccaagggcagttcaagtcc
acagtgcagtgcctgacctgccataaaaagtctcggacctttgaggcctttatgtatttg
tccttgccgcttgcgtccactagcaaatgcacgttgcaggagtgctttagattgttctcc
aaagaagaaaaactgacagataacaatagattttactgtagtcattgcaaaacccgaaga
gactctttgaaaaaaatagagatctggaagctgcctcctgtgcttttagttcatttgaaa
aggttttcttacgatggacgatggaagcaaaagcttcagacatcggttgatttccccttg
gaaagtcttgacgtgtcgcaatacgttattggcccaaagagtaactcaaagagatacaac
ctgtttgccgtatctaaccattatggagggctggacggagggcactataccgcctattgc
aaaaacgctaccaaacagcgctggtataagtttgacgaccacgaagtctcggagatctcc
acttcctccgtgaaatcttcagccgcctatatcctcttttacacatctcttgaacagcga
gcccttgatacagctacataa

DBGET integrated database retrieval system