KEGG   Anolis carolinensis (green anole): 100558633Help
Entry
100558633         CDS       T01608                                 

Gene name
usp8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100558633 (usp8)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100558633 (usp8)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100558633 (usp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1066 aa AA seqDB search
MPAVASVPKDLYLCTSLKDLNKKTEIKPEKTSTKSYVQSALKIFKPDFKQQQDYFHSLLG
PTNVKKAIEEAERLSESLKLRYEEAEVRKKLEERERLEEQQLKKQESKDDAKALSKTSSE
ISSDPKGKNQIHYSFSQGAITAEKLFTMMMDKSIKLMIMDARCLKDYQESCIINSVCVPE
EAITPGETANLIEAKLPEASKEAWKERGQASYVVLLDWFSSVKDLQLGTPLRSLKDALFK
WESKAVLQNEPLVLDGGYENWLLCYPQYTTNAKVIPPQRSKSEAVSVSLDFTYPSLEEPV
PPPLPVVHVKPSVVEVTERPETTNDQERKIEAFKPPVSAGSVAVAFKGDSSSPIVPPVPA
MKIIPQVDRTKKPSTKIPDGDDKPKADSPVINKPLISNGKVVPDRSKKPPLDTKVSLSEE
EKIHIPGEKASQLEKNRQEKELQEEQKEKLKQTKHDQEPTAKEEQEKEGRETLLNEKEQA
SRGTGDKQEMDKAPKELTDFKKTSKVVTETPEVKKNDSEKTKVTWTPEIQRHKFAEESRA
SVRGDTVSSKQTEIKHQAETQKPGDIREDTEQESEKNKSQREPLTRARSEEMGRIIPGLP
AGWAKFLDPITGTFRYYHSPTNTVHMYPPEMTPSATPPSTPPTHKPKPRAADQREREHSK
LKRSYSSPDITQAIQEEERKKVTITPTINRENKPVSYPKAEISRLSASQIRNLNPVFGGM
GPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNYYQVDINRSNFLGHKGEVAEEFGI
IMKALWAGQYRYISPKDFKMTIGKINDQFAGYSQQDSQELLLFLMDDLHEDLNKADNRKR
YKEENNDDLDDPKAADLAWHKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYL
SLPLASTSKCTLQECFRLFSKEEKLTDNNRFYCSHCKTRRDSLKKIEIWKLPPVLLVHLK
RFSYDGRWKQKLQTSVDFPLESLDVSQYVIGPKSNSKRYNLFAVSNHYGGLDGGHYTAYC
KNATKQRWYKFDDHEVSEISTSSVKSSAAYILFYTSLEQRALDTAT
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcatctgtacctaaagacctatatctgtgcacttcattgaaagatctt
aacaaaaagacagaaataaaacctgagaaaaccagtactaagagttatgtacagagtgct
cttaagatcttcaaacccgatttcaaacaacaacaagattactttcattccctacttgga
cctaccaatgttaaaaaagctatcgaagaggctgaaaggctttcagaaagtcttaaactt
aggtatgaagaggcagaagtgcggaagaaactggaagaaagggaaagattggaagagcaa
cagctgaaaaaacaagaatcaaaagatgatgcaaaggctttatcaaaaacatcttcagaa
atttcatcagatcctaaaggaaaaaatcaaatacactattccttctctcaaggagcaatc
acggcagagaaattgtttacaatgatgatggacaaaagcatcaagctgatgataatggat
gctcgatgcttaaaggattaccaggagtcctgcatcataaactccgtctgtgttccagaa
gaagctatcactccaggagaaaccgctaacctgattgaagctaagctcccagaggcttct
aaagaggcatggaaagagagggggcaagccagttatgttgttttgctcgactggtttagt
tcggtaaaggatttgcaattgggaacacctttgcgaagcctcaaagatgcgcttttcaag
tgggaaagtaaagctgtgctacagaatgagcccttggtcttagatggaggttatgagaac
tggcttctttgctatccccagtatacgacaaatgccaaagtcattccaccgcaacgcagc
aagagcgaagcggtttctgtttctctggattttacatatccgtctttggaagaaccagtt
ccccctccgctacctgttgttcatgtaaaaccttctgtggtggaagtgacagagagacct
gaaaccacaaatgatcaggaaaggaaaatagaggcatttaaaccaccagtttctgctggc
tcagttgctgttgcttttaagggcgacagttcatctcccattgtcccgccagtacctgcc
atgaagattatccctcaggttgatcgtacaaaaaagccttcaacaaaaattccggacggt
gatgataagccgaaagctgacagcccagttattaataaaccacttatttcaaatgggaaa
gtggtcccagaccgctccaagaagccaccattggatacaaaggtcagcctgagcgaagaa
gagaaaatccacatccctggagaaaaagcttctcagctagaaaaaaacaggcaggaaaaa
gaactgcaggaagaacagaaagagaagttgaaacagacaaagcacgaccaagaaccaaca
gctaaagaggagcaggaaaaggaaggccgagaaactcttttgaacgaaaaagaacaggcc
agtagaggaacaggggacaagcaagagatggacaaggcaccaaaagaattaacagacttt
aaaaagacaagtaaagttgtgactgaaactcctgaagtgaaaaaaaatgacagcgagaaa
acaaaggtgacctggacgccagaaatccagaggcacaaatttgcagaggagtcccgtgcc
tccgtgcggggcgacactgtctctagcaagcagactgagattaaacaccaagcagaaact
caaaaaccaggagatattagagaagatactgaacaagagtctgaaaaaaataaatcccaa
cgggaaccattaacaagagcacggagcgaggagatggggagaattataccaggattgcct
gctggctgggctaaatttcttgatccaattaccgggacattccgttactaccactctccg
accaacactgttcatatgtatcctccggaaatgaccccgtcggccactccaccttctact
cctccgactcataaacccaaacctcgggctgcggatcagcgggagagagagcactccaaa
ctgaagcgctcatactcctctccagacataacccaggccatccaggaggaggagagaaag
aaagtcaccatcacccccaccatcaatcgcgaaaataaaccagtaagctatcctaaagct
gaaatctcaaggctttctgcatctcagattcgtaatctcaaccctgtatttgggggaatg
ggaccagcgctcacaggccttcgaaatttaggaaatacttgctatatgaactccatctta
caatgcctgtgtaatgccccacatctagcggattacttcaacagaaattattatcaagtt
gatatcaacaggtcaaatttcctggggcacaaaggtgaggtggcagaggagtttggcatc
atcatgaaagccctctgggctggacagtaccgatatatcagtcccaaagacttcaagatg
accattgggaagatcaatgaccaatttgcagggtacagtcagcaggactctcaagagctg
ctcttgtttttaatggatgacctccatgaagacttgaataaagccgacaacagaaagcgt
tacaaagaggaaaacaatgatgacctggatgaccccaaagcggccgacttggcctggcac
aagcacaagcagctcaacgagtccattattgtggcactcttccaagggcagttcaagtcc
acagtgcagtgcctgacctgccataaaaagtctcggacctttgaggcctttatgtatttg
tccttgccgcttgcgtccactagcaaatgcacgttgcaggagtgctttagattgttctcc
aaagaagaaaaactgacagataacaatagattttactgtagtcattgcaaaacccgaaga
gactctttgaaaaaaatagagatctggaagctgcctcctgtgcttttagttcatttgaaa
aggttttcttacgatggacgatggaagcaaaagcttcagacatcggttgatttccccttg
gaaagtcttgacgtgtcgcaatacgttattggcccaaagagtaactcaaagagatacaac
ctgtttgccgtatctaaccattatggagggctggacggagggcactataccgcctattgc
aaaaacgctaccaaacagcgctggtataagtttgacgaccacgaagtctcggagatctcc
acttcctccgtgaaatcttcagccgcctatatcctcttttacacatctcttgaacagcga
gcccttgatacagctacataa

DBGET integrated database retrieval system