KEGG   Anolis carolinensis (green anole): 100558980Help
Entry
100558980         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 48-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100558980
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100558980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 506 aa AA seqDB search
RNCRGNPNCLVGIGEQAWLGEIDEDAFHNIEDPNAERRKKNAFVGLTNLGATCYVNTFLQ
MWFLNLELRQALYLCPSPRPSGPTAAEGPSVSTDQDYEPQSICEHLQYLFALLQSSRRRY
IDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSSQKNPEVRDIVQKQFCGEYAYVTV
CNQCGRESKLISKFYELELNIQGHKQLSDCITEFLKEEKLEGDNRYFCETCQSKQNATRR
IRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIEFSDLLDMEPFMEDKGGHFTYELSAIL
IHRGVSAYSGHYIAHVKDPQTAEWYRFNDEEIEKMEGKKLQLGAEEDLEPSKSQARKPKG
GKGVYRSRNAYMLVYRLQSRAKSLTTDIPAFLKELVERDNSKFEEWCAEMAEMRQQSVAR
GKVKHEEVKELYQKLPAKAGDPYDFVSLEWLQQWLDEAAAPKPVDNRPCLCPHGKLNPDK
VPAIKRVSATVADYFYQRYGGGPRLT
NT seq 1520 nt NT seq  +upstreamnt  +downstreamnt
gaggaactgccgggggaaccccaactgcttggtgggcattggggagcaggcctggctggg
agagatcgacgaggatgcctttcacaacatcgaggacccaaacgccgagagacggaaaaa
gaatgcctttgtgggcctcaccaacctgggtgccacctgctacgtcaacaccttcctcca
gatgtggttcctgaacctggagctgcggcaggcgctctacctctgccccagtccccgtcc
cagcggacccacagccgcagaagggccctccgtcagcacagatcaggattacgagccgca
gagcatctgtgagcaccttcagtacttgtttgccttgctgcagagcagccggcggcggta
catcgacccttcgggctttgtgaaggctctgggcttggacacaggtcagcagcaggacgc
gcaggagttttccaagctgttcatgtcgctcttagaagacacgctttcctcccaaaagaa
cccagaagttcgtgacattgtccagaagcagttttgcggagaatacgcctatgttactgt
ttgcaaccagtgtggccgggagtccaagctgatctcgaaattttatgagctcgaattgaa
catccagggccacaagcagctctcggactgcatcactgagttcctaaaggaagagaagct
ggagggcgacaaccgctacttctgcgaaacctgccagagcaaacagaatgccacgcgccg
gatccggctgctcagcctgccctgcaccctcaacctccagctcatgcgcttcgtctttga
caggcaaacaggccacaagaagaagctgaacacctacattgagttctcggatctgctgga
catggagccgttcatggaggacaaaggtgggcacttcacctacgaactgagcgccatcct
gatccaccgcggggtgagcgcctactccggccactacattgcccacgtcaaggaccccca
gacggccgagtggtatcgcttcaacgacgaggagatcgagaagatggaggggaagaagct
ccagctgggagccgaggaggatctggagccttccaagtcgcaggcccggaagcccaaggg
cgggaagggggtctaccgctcccggaacgcctacatgctggtctataggctgcagtcgcg
ggccaagtccctgaccacagacatcccagctttcctgaaagaactggtggagcgggacaa
cagcaagttcgaggagtggtgcgcggagatggcggagatgcggcagcagagcgtggcccg
gggcaaagtcaagcacgaggaggtgaaggagctctaccagaagttgcccgctaaggctgg
cgacccttatgacttcgtgtccctggagtggctgcagcagtggctggacgaggccgccgc
cccgaagcccgtcgacaaccggccctgcttgtgtccccacgggaagctgaacccggacaa
ggtccccgccatcaagagggtctccgccactgtggccgactacttctaccagcgctacgg
gggcgggccccgtctgaccg

DBGET integrated database retrieval system